KEGG   Mus musculus (mouse): 12984Help
Entry
12984             CDS       T01002                                 

Gene name
Csf2rb2, AIC2A, BetaIl3, Bil3, Csfgmrb, Il3r, Il3rb, Il3rb2
Definition
(RefSeq) colony stimulating factor 2 receptor, beta 2, low-affinity (granulocyte-macrophage)
  KO
K04738  cytokine receptor common subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04210  Apoptosis
mmu04630  Jak-STAT signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    12984 (Csf2rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12984 (Csf2rb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12984 (Csf2rb2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    12984 (Csf2rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12984 (Csf2rb2)
   04090 CD molecules [BR:mmu04090]
    12984 (Csf2rb2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   12984 (Csf2rb2)
CD molecules [BR:mmu04090]
 Proteins
  12984 (Csf2rb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind EpoR_lig-bind IL4Ra_N fn3 Interfer-bind IL2RB_N1 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 12984
NCBI-ProteinID: NP_031807
MGI: 1339760
Ensembl: ENSMUSG00000071714
UniProt: P26954
Structure
PDB: 

Position
15 E1; 15 37.22 cM
AA seq 878 aa AA seqDB search
MDQQMALTWGLCYMALVALCWGHEVTEEEETVPLKTLECYNDYTNRIICSWADTEDAQGL
INMTLLYHQLDKIQSVSCELSEKLMWSECPSSHRCVPRRCVIPYTRFSNGDNDYYSFQPD
RDLGIQLMVPLAQHVQPPPPKDIHISPSGDHFLLEWSVSLGDSQVSWLSSKDIEFEVAYK
RLQDSWEDASSLHTSNFQVNLEPKLFLPNSIYAARVRTRLSAGSSLSGRPSRWSPEVHWD
SQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPAAPEEKCSPVVKEP
QASVYTRYRCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYYHIQMEPPILNQTKNRDSYSL
HWETQKIPKYIDHTFQVQYKKKSESWKDSKTENLGRVNSMDLPQLEPDTSYCARVRVKPI
SDYDGIWSEWSNEYTWTTDWVMPTLWIVLILVFLIFTLLLALHFGRVYGYRTYRKWKEKI
PNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGVSYEHLEDNNVSPLT
IEDPNIIRDPPSRPDTTPAASSESTEQLPNVQVEGPIPSSRPRKQLPSFDFNGPYLGPPQ
SHSLPDLPGQLGSPQVGGSLKPALPGSLEYMCLPPGGQVQLVPLSQVMGQGQAMDVQCGS
SLETTGSPSVEPKENPPVELSVEKQEARDNPMTLPISSGGPEGSMMASDYVTPGDPVLTL
PTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAATSPP
GHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPS
PSLCSETEDLDQDLSVKKFPYQPLPQAPAIQFFKSLKY
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcaaatggcactcacatgggggctgtgctacatggcactggtggctctctgc
tggggacacgaggtgacagaggaagaagaaacggtccctctgaagactctggagtgctac
aatgactacaccaaccgtatcatctgcagctgggcagacacagaggatgcccaggggcta
atcaacatgaccctcctctatcaccagctagacaagattcaatcagtgtcctgtgagctc
agtgagaaactcatgtggtcagagtgcccgtcatcccaccgctgtgtgcccagaagatgt
gtcatcccctacacacgattttctaatggagataacgactactactccttccagccagat
cgtgacctgggcatccagctcatggtcccactggcccagcatgtgcagccaccccctccc
aaggacatccacatcagcccctctggggatcatttcctgctggaatggagtgtatctctt
ggggattcccaggtctcctggctttcatcaaaggacatagagtttgaggtggcttataag
cggcttcaggactcctgggaggatgcctccagtctccacactagcaactttcaggtgaat
ttagagccaaagctattcctacccaacagcatctatgctgcccgtgtgcgcactcggctg
tccgcgggttcaagcttgtctgggagacccagcagatggagcccagaggttcactgggac
tcccagccaggggacaaggcccagccacagaaccttcaatgcttctttgatgggatccag
tctctccactgctcctgggaggtgtggacccagacgactggctctgtttcctttgggctc
ttctatcgccccagccctgcagctccggaggagaaatgctctccggtggtgaaggagccg
caggccagcgtctacacccgctaccgctgcagtctacctgtgcctgagcccagtgcacac
agccagtacacagtctctgttaagcacctggaacaagggaagttcatcatgagctattac
cacatccagatggaacctccaatcctcaaccagaccaagaacagagacagctacagcctg
cattgggaaactcagaaaatacccaaatacattgatcacactttccaggtccagtacaag
aagaagtcagagagctggaaggacagcaagacagaaaacctaggtcgagtcaatagcatg
gacctgccccagctggagccggacacctcatactgcgccagggtgagggtcaagcccatc
tctgactacgacgggatctggagcgagtggagcaatgagtacacttggacgactgactgg
gtgatgcccacgctgtggatagtcctcatcctggtctttctcatcttcaccttgctcctg
gctctccactttggccgtgtttatgggtacaggacatacaggaagtggaaggaaaagatc
cccaaccccagcaagagcctcctgttccaggatggaggtaaaggtctctggcctcctggc
agcatggcagccttcgcgactaagaaccccgctctccaggggccacagagcaggcttctt
gctgagcaacagggggtgtcatatgaacatttggaagacaacaacgtgtcacctctcact
atagaggaccctaatataattcgagatccaccatccaggcctgatacaaccccagctgcc
tcatctgaatccacagagcaacttcccaatgttcaagtagagggaccaattccttctagc
cgacccaggaagcaattacccagctttgacttcaatgggccctacctggggcctccccaa
tcccactccctgcctgatctcccaggccagctgggttctccccaggtgggtgggagcctg
aagccagcactgccaggctccttggagtacatgtgtctgccccctggaggtcaagtgcaa
ctggtcccattgtcccaggtgatgggacagggccaggctatggatgtgcagtgtgggtcc
agcctggagaccacagggagcccttccgtggagccaaaggagaaccctccagttgagctg
agcgtggagaaacaggaggcaagggacaacccaatgactcttcccataagctctgggggc
cctgagggcagtatgatggcctctgattatgtcactcctggagatccggtgctcactctg
cccacagggcccctgtctacctctctgggcccctctctagggttgccctcagcccaaagc
cccagtctctgtcttaagctgcccagggtcccctctggaagcccagctctagggccacca
gggtttgaggactatgtggagctgcctccaagtgtgagccaggcagccacgtcccctcca
ggccatcctgctcctcctgtggcaagcagccccacagtgatcccaggagagcccagggag
gaagtgggcccagcatccccacatcccgaaggcctccttgttcttcagcaggttggggac
tactgcttcctccctggcctgggacctggctccctctcaccacacagtaagccaccctct
ccaagtctgtgttctgagactgaggacctagaccaggacttgtctgtgaaaaagtttccc
tatcaacccttgccccaggccccagccattcagtttttcaagtccctaaagtattag

DBGET integrated database retrieval system