KEGG   Mus musculus (mouse): 12985
Entry
12985             CDS       T01002                                 

Gene name
Csf3, Csf, Csfg, G-CS, G-CSF, MGI-, MGI-IG
Definition
(RefSeq) colony stimulating factor 3 (granulocyte)
  KO
K05423  granulocyte colony-stimulating factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu05144  Malaria
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12985 (Csf3)
   04151 PI3K-Akt signaling pathway
    12985 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12985 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12985 (Csf3)
   04657 IL-17 signaling pathway
    12985 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12985 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    12985 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12985 (Csf3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   12985 (Csf3)
SSDB
Motif
Pfam: GCSF IL6 IL11
Other DBs
NCBI-GeneID: 12985
NCBI-ProteinID: NP_034101
MGI: 1339751
Ensembl: ENSMUSG00000038067
Vega: OTTMUSG00000006406
UniProt: P09920 Q0VB73
Position
11 D; 11 62.45 cM
AA seq 208 aa
MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKI
QASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCL
YQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAF
QRRAGGVLAISYLQGFLETARLALHHLA
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcaactttctgcccagaggcgcatgaagctaatggccctgcagctgctgctgtgg
caaagtgcactatggtcaggacgagaggccgttcccctggtcactgtcagcgctctgcca
ccatccctgcctctgccccgaagcttcctgcttaagtccctggagcaagtgaggaagatc
caggccagcggctcggtgctgctggagcagttgtgtgccacctacaagctgtgtcacccc
gaggagctggtgttgctgggccactctctggggatcccgaaggcttccctgagtggctgc
tctagccaggccctgcagcagacacagtgcctaagccagctccacagtgggctctgcctc
taccaaggtctcctgcaggctctatcgggtatttcccctgccctggcccccaccttggac
ttgcttcagctggatgttgccaactttgccaccaccatctggcagcagatggaaaaccta
ggggtggcccctactgtgcagcccacacagagcgccatgccagccttcacttctgccttc
cagcgccgggcaggaggtgtcctggccatttcgtacctgcagggcttcctggagacggct
cgccttgctctgcaccacttggcctag

DBGET integrated database retrieval system