KEGG   Mus musculus (mouse): 12985
Entry
12985             CDS       T01002                                 

Gene name
Csf3, Csf, Csfg, G-CS, G-CSF, MGI-, MGI-IG
Definition
(RefSeq) colony stimulating factor 3 (granulocyte)
  KO
K05423  granulocyte colony-stimulating factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu05144  Malaria
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12985 (Csf3)
   04151 PI3K-Akt signaling pathway
    12985 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12985 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12985 (Csf3)
   04657 IL-17 signaling pathway
    12985 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12985 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    12985 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12985 (Csf3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   12985 (Csf3)
SSDB
Motif
Pfam: GCSF IL6 IL11
Other DBs
NCBI-GeneID: 12985
NCBI-ProteinID: NP_034101
MGI: 1339751
Ensembl: ENSMUSG00000038067
Vega: OTTMUSG00000006406
UniProt: P09920 Q0VB73
Position
11 D; 11 62.45 cM
AA seq 208 aa
MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKI
QASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCL
YQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAF
QRRAGGVLAISYLQGFLETARLALHHLA
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcaactttctgcccagaggcgcatgaagctaatggccctgcagctgctgctgtgg
caaagtgcactatggtcaggacgagaggccgttcccctggtcactgtcagcgctctgcca
ccatccctgcctctgccccgaagcttcctgcttaagtccctggagcaagtgaggaagatc
caggccagcggctcggtgctgctggagcagttgtgtgccacctacaagctgtgtcacccc
gaggagctggtgttgctgggccactctctggggatcccgaaggcttccctgagtggctgc
tctagccaggccctgcagcagacacagtgcctaagccagctccacagtgggctctgcctc
taccaaggtctcctgcaggctctatcgggtatttcccctgccctggcccccaccttggac
ttgcttcagctggatgttgccaactttgccaccaccatctggcagcagatggaaaaccta
ggggtggcccctactgtgcagcccacacagagcgccatgccagccttcacttctgccttc
cagcgccgggcaggaggtgtcctggccatttcgtacctgcagggcttcctggagacggct
cgccttgctctgcaccacttggcctag

KEGG   Mus musculus (mouse): 13856
Entry
13856             CDS       T01002                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    13856 (Epo)
   04066 HIF-1 signaling pathway
    13856 (Epo)
   04151 PI3K-Akt signaling pathway
    13856 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13856 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    13856 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13856 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13856 (Epo)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   13856 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 13856
NCBI-ProteinID: NP_031968
MGI: 95407
Ensembl: ENSMUSG00000029711
Vega: OTTMUSG00000021944
UniProt: P07321 Q0VED9
Position
5 G2; 5 76.5 cM
AA seq 192 aa
MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPR
LSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLH
IDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKLK
LYTGEVCRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgctgcttttactctccttgctactgattcctctg
ggcctcccagtcctctgtgctcccccacgcctcatctgcgacagtcgagttctggagagg
tacatcttagaggccaaggaggcagaaaatgtcacgatgggttgtgcagaaggtcccaga
ctgagtgaaaatattacagtcccagataccaaagtcaacttctatgcttggaaaagaatg
gaggtggaagaacaggccatagaagtttggcaaggcctgtccctgctctcagaagccatc
ctgcaggcccaggccctgctagccaattcctcccagccaccagagacccttcagcttcat
atagacaaagccatcagtggtctacgtagcctcacttcactgcttcgggtactgggagct
cagaaggaattgatgtcgcctccagataccaccccacctgctccactccgaacactcaca
gtggatactttctgcaagctcttccgggtctacgccaacttcctccgggggaaactgaag
ctgtacacgggagaggtctgcaggagaggggacaggtga

KEGG   Mus musculus (mouse): 14599
Entry
14599             CDS       T01002                                 

Gene name
Gh, Gh1, Ghb1
Definition
(RefSeq) growth hormone
  KO
K05438  growth hormone
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    14599 (Gh)
   04151 PI3K-Akt signaling pathway
    14599 (Gh)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14599 (Gh)
   04060 Cytokine-cytokine receptor interaction
    14599 (Gh)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    14599 (Gh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14599 (Gh)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   14599 (Gh)
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 14599
NCBI-ProteinID: NP_032143
MGI: 95707
Ensembl: ENSMUSG00000020713
Vega: OTTMUSG00000003423
UniProt: P06880 A0A0M6L0K7
Position
11 E1; 11 68.89 cM
AA seq 216 aa
MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA
YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR
IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL
LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctacagactctcggacctcctggctcctgaccgtcagcctgctctgcctgctctgg
cctcaggaggctagtgcttttcccgccatgcccttgtccagtctgttttctaatgctgtg
ctccgagcccagcacctgcaccagctggctgctgacacctacaaagagttcgagcgtgcc
tacattcccgagggacagcgctattccattcagaatgcccaggctgctttctgcttctca
gagaccatcccggcccccacaggcaaggaggaggcccagcagagaaccgacatggaattg
cttcgcttctcgctgctgctcatccagtcatggctggggcccgtgcagttcctcagcagg
attttcaccaacagcctgatgttcggcacctcggaccgtgtctatgagaaactgaaggac
ctggaagagggcatccaggctctgatgcaggagctggaagatggcagcccccgtgttggg
cagatcctcaagcaaacctatgacaagtttgacgccaacatgcgcagcgacgacgcgctg
ctcaaaaactatgggctgctctcctgcttcaagaaggacctgcacaaagcggagacctac
ctgcgggtcatgaagtgtcgccgctttgtggaaagcagctgtgccttctag

KEGG   Mus musculus (mouse): 15962
Entry
15962             CDS       T01002                                 

Gene name
Ifna1, If, Ifa1
Definition
(RefSeq) interferon alpha 1
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15962 (Ifna1)
   04151 PI3K-Akt signaling pathway
    15962 (Ifna1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15962 (Ifna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15962 (Ifna1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15962 (Ifna1)
   04621 NOD-like receptor signaling pathway
    15962 (Ifna1)
   04622 RIG-I-like receptor signaling pathway
    15962 (Ifna1)
   04623 Cytosolic DNA-sensing pathway
    15962 (Ifna1)
   04650 Natural killer cell mediated cytotoxicity
    15962 (Ifna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15962 (Ifna1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15962 (Ifna1)
   05161 Hepatitis B
    15962 (Ifna1)
   05160 Hepatitis C
    15962 (Ifna1)
   05171 Coronavirus disease - COVID-19
    15962 (Ifna1)
   05164 Influenza A
    15962 (Ifna1)
   05162 Measles
    15962 (Ifna1)
   05168 Herpes simplex virus 1 infection
    15962 (Ifna1)
   05163 Human cytomegalovirus infection
    15962 (Ifna1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15962 (Ifna1)
   05169 Epstein-Barr virus infection
    15962 (Ifna1)
   05165 Human papillomavirus infection
    15962 (Ifna1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15962 (Ifna1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15962 (Ifna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15962 (Ifna1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15962 (Ifna1)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 15962
NCBI-ProteinID: NP_034632
MGI: 107668
Ensembl: ENSMUSG00000095498
Vega: OTTMUSG00000007695
UniProt: P01572
Position
4 C4; 4 42.04 cM
AA seq 189 aa
MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggtcctggcggtgctgagctactggccaacctgc
tctctaggatgtgaccttcctcagactcataacctcaggaacaagagagccttgacactc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttcccgcaggagaaggtggatgcccagcagatcaagaaggctcaagccatccctgtcctg
agtgagctgacccagcagatcctgaacatcttcacatcaaaggactcatctgctgcatgg
aatacaaccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggaatttcccctgacccaggaagatgccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctctgccaat
gtgctgggaagactgagagaagagaaatga

KEGG   Mus musculus (mouse): 15964
Entry
15964             CDS       T01002                                 

Gene name
Ifna11, IFN-[a, IFN-[a]11
Definition
(RefSeq) interferon alpha 11
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15964 (Ifna11)
   04151 PI3K-Akt signaling pathway
    15964 (Ifna11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15964 (Ifna11)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15964 (Ifna11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15964 (Ifna11)
   04621 NOD-like receptor signaling pathway
    15964 (Ifna11)
   04622 RIG-I-like receptor signaling pathway
    15964 (Ifna11)
   04623 Cytosolic DNA-sensing pathway
    15964 (Ifna11)
   04650 Natural killer cell mediated cytotoxicity
    15964 (Ifna11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15964 (Ifna11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15964 (Ifna11)
   05161 Hepatitis B
    15964 (Ifna11)
   05160 Hepatitis C
    15964 (Ifna11)
   05171 Coronavirus disease - COVID-19
    15964 (Ifna11)
   05164 Influenza A
    15964 (Ifna11)
   05162 Measles
    15964 (Ifna11)
   05168 Herpes simplex virus 1 infection
    15964 (Ifna11)
   05163 Human cytomegalovirus infection
    15964 (Ifna11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15964 (Ifna11)
   05169 Epstein-Barr virus infection
    15964 (Ifna11)
   05165 Human papillomavirus infection
    15964 (Ifna11)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15964 (Ifna11)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15964 (Ifna11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15964 (Ifna11)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15964 (Ifna11)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15964
NCBI-ProteinID: NP_032359
MGI: 109210
Ensembl: ENSMUSG00000100549
Vega: OTTMUSG00000011274
UniProt: Q61716
Position
4 C4; 4 42.03 cM
AA seq 190 aa
MARLCAFLMILIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMRRLTPLSCLKDRKDFG
FPLEKVDAQQIQKAQSIPVLRDLTQQILNLFASKDSSAAWNATLLDSFCNDLHQQLNDLQ
GCLMQQVGVQESPLTQEDSLLAVRIYFHRITVFLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEKA
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcttgatagtgatgagctactggtcaacctgt
tctctaggatgcgatctgcctcacacttataacctcaggaacaagagggccttgaaggtc
ctggcacaaatgaggaggctcacccctctttcctgcctaaaggacaggaaggactttgga
ttccccttggagaaggtggatgcccagcagatccagaaggctcaatccatccctgtgctg
cgagatcttacccagcagatcttgaacctcttcgcatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
ggttgtctgatgcagcaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggatatacttccacaggatcactgtgttcctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctctgccaat
gtgctgggaagactgagagaagagaaggcttga

KEGG   Mus musculus (mouse): 15965
Entry
15965             CDS       T01002                                 

Gene name
Ifna2, If, Ifa2
Definition
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15965 (Ifna2)
   04151 PI3K-Akt signaling pathway
    15965 (Ifna2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15965 (Ifna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15965 (Ifna2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15965 (Ifna2)
   04621 NOD-like receptor signaling pathway
    15965 (Ifna2)
   04622 RIG-I-like receptor signaling pathway
    15965 (Ifna2)
   04623 Cytosolic DNA-sensing pathway
    15965 (Ifna2)
   04650 Natural killer cell mediated cytotoxicity
    15965 (Ifna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15965 (Ifna2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15965 (Ifna2)
   05161 Hepatitis B
    15965 (Ifna2)
   05160 Hepatitis C
    15965 (Ifna2)
   05171 Coronavirus disease - COVID-19
    15965 (Ifna2)
   05164 Influenza A
    15965 (Ifna2)
   05162 Measles
    15965 (Ifna2)
   05168 Herpes simplex virus 1 infection
    15965 (Ifna2)
   05163 Human cytomegalovirus infection
    15965 (Ifna2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15965 (Ifna2)
   05169 Epstein-Barr virus infection
    15965 (Ifna2)
   05165 Human papillomavirus infection
    15965 (Ifna2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15965 (Ifna2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15965 (Ifna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15965 (Ifna2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15965 (Ifna2)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 15965
NCBI-ProteinID: NP_034633
MGI: 107666
Ensembl: ENSMUSG00000078354
Vega: OTTMUSG00000011279
UniProt: B1AYH7
Position
4 C4; 4 42.02 cM
AA seq 190 aa
MARLCAFLVMLIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFG
FPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNTTLLDSFCNDLHQQLNDLQ
TCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVN
LLPRLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctagactctgtgctttcctcgtgatgctgatagtgatgagctactggtcaacctgt
tctctaggatgcgatctgcctcacacttataacctcaggaacaagagggccttgaaggtc
ctggcacagatgaggaggctcccctttctctcctgcctgaaggacaggcaggactttgga
ttccccctggagaaggtggataaccagcagatccagaaggctcaagccatccctgtgctg
cgagatcttactcagcagaccttgaacctcttcacatcaaaggcttcatctgctgcttgg
aatacaaccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
acctgtctgatgcagcaggtgggggtgcaggaacctcctctgacccaggaagacgccctg
ctggctgtgaggaaatatttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagtcaac
ttgctgccaagactgagtgaagagaaggagtga

KEGG   Mus musculus (mouse): 15967
Entry
15967             CDS       T01002                                 

Gene name
Ifna4, If, Ifa4
Definition
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15967 (Ifna4)
   04151 PI3K-Akt signaling pathway
    15967 (Ifna4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15967 (Ifna4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15967 (Ifna4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15967 (Ifna4)
   04621 NOD-like receptor signaling pathway
    15967 (Ifna4)
   04622 RIG-I-like receptor signaling pathway
    15967 (Ifna4)
   04623 Cytosolic DNA-sensing pathway
    15967 (Ifna4)
   04650 Natural killer cell mediated cytotoxicity
    15967 (Ifna4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15967 (Ifna4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15967 (Ifna4)
   05161 Hepatitis B
    15967 (Ifna4)
   05160 Hepatitis C
    15967 (Ifna4)
   05171 Coronavirus disease - COVID-19
    15967 (Ifna4)
   05164 Influenza A
    15967 (Ifna4)
   05162 Measles
    15967 (Ifna4)
   05168 Herpes simplex virus 1 infection
    15967 (Ifna4)
   05163 Human cytomegalovirus infection
    15967 (Ifna4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15967 (Ifna4)
   05169 Epstein-Barr virus infection
    15967 (Ifna4)
   05165 Human papillomavirus infection
    15967 (Ifna4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15967 (Ifna4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15967 (Ifna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15967 (Ifna4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15967 (Ifna4)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15967
NCBI-ProteinID: NP_034634
MGI: 107664
Ensembl: ENSMUSG00000070904
Vega: OTTMUSG00000011263
UniProt: P07351 Q540C2
Position
4 C4; 4 42.03 cM
AA seq 186 aa
MARLCAFLMILVMMSYYWSACSLGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDF
GFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDL
KACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLAR
LSEEKE
NT seq 561 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcctggtaatgatgagctactactggtcagcc
tgttctctaggatgtgacctgcctcacacttataacctcgggaacaagagggccttgaca
gtcctggaagaaatgagaagactcccccctctttcctgcctgaaggacaggaaggatttt
ggattccccttggagaaggtggataaccaacagatccagaaggctcaagccatccttgtg
ctaagagatcttacccagcagattttgaacctcttcacatcaaaagacttgtctgctact
tggaatgcaactctactagactcattctgcaatgacctccatcagcagctcaatgacctc
aaagcctgtgtgatgcaggaacctcctctgacccaggaagactccctgctggctgtgagg
acatacttccacaggatcactgtgtacctgagaaagaagaaacacagcctctgtgcctgg
gaggtgatcagagcagaagtctggagagccctctcttcctcaaccaacttgctggcaaga
ctgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 15968
Entry
15968             CDS       T01002                                 

Gene name
Ifna5, If, Ifa5
Definition
(RefSeq) interferon alpha 5
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15968 (Ifna5)
   04151 PI3K-Akt signaling pathway
    15968 (Ifna5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15968 (Ifna5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15968 (Ifna5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15968 (Ifna5)
   04621 NOD-like receptor signaling pathway
    15968 (Ifna5)
   04622 RIG-I-like receptor signaling pathway
    15968 (Ifna5)
   04623 Cytosolic DNA-sensing pathway
    15968 (Ifna5)
   04650 Natural killer cell mediated cytotoxicity
    15968 (Ifna5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15968 (Ifna5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15968 (Ifna5)
   05161 Hepatitis B
    15968 (Ifna5)
   05160 Hepatitis C
    15968 (Ifna5)
   05171 Coronavirus disease - COVID-19
    15968 (Ifna5)
   05164 Influenza A
    15968 (Ifna5)
   05162 Measles
    15968 (Ifna5)
   05168 Herpes simplex virus 1 infection
    15968 (Ifna5)
   05163 Human cytomegalovirus infection
    15968 (Ifna5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15968 (Ifna5)
   05169 Epstein-Barr virus infection
    15968 (Ifna5)
   05165 Human papillomavirus infection
    15968 (Ifna5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15968 (Ifna5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15968 (Ifna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15968 (Ifna5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15968 (Ifna5)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15968
NCBI-ProteinID: NP_034635
MGI: 107663
Ensembl: ENSMUSG00000096682
Vega: OTTMUSG00000011264
UniProt: Q810G2
Structure
PDB: 
3OQ3

Position
4 C4; 4 42.03 cM
AA seq 189 aa
MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFG
FPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLK
ACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVN
LLARLSKEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggtcctggcggtgctgagctactggccaacctgc
tctctaggatgtgaccttcctcagactcataacctcaggaacaagagagccttaaccctc
ctggtaaaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttgga
ttcccacaggagaaggtgggtgcccagcagatccaggaggctcaagccatccctgtcctg
agtgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcatgg
aatgcaaccctcctagactcattctgcaatgaagtccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaacaggtcggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagttaac
ttgctggcaagattgagcaaggaggagtga

KEGG   Mus musculus (mouse): 15969
Entry
15969             CDS       T01002                                 

Gene name
Ifna6, IFNa8/6, If, Ifa6, Ifa8, Ifna8
Definition
(RefSeq) interferon alpha 6
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15969 (Ifna6)
   04151 PI3K-Akt signaling pathway
    15969 (Ifna6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15969 (Ifna6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15969 (Ifna6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15969 (Ifna6)
   04621 NOD-like receptor signaling pathway
    15969 (Ifna6)
   04622 RIG-I-like receptor signaling pathway
    15969 (Ifna6)
   04623 Cytosolic DNA-sensing pathway
    15969 (Ifna6)
   04650 Natural killer cell mediated cytotoxicity
    15969 (Ifna6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15969 (Ifna6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15969 (Ifna6)
   05161 Hepatitis B
    15969 (Ifna6)
   05160 Hepatitis C
    15969 (Ifna6)
   05171 Coronavirus disease - COVID-19
    15969 (Ifna6)
   05164 Influenza A
    15969 (Ifna6)
   05162 Measles
    15969 (Ifna6)
   05168 Herpes simplex virus 1 infection
    15969 (Ifna6)
   05163 Human cytomegalovirus infection
    15969 (Ifna6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15969 (Ifna6)
   05169 Epstein-Barr virus infection
    15969 (Ifna6)
   05165 Human papillomavirus infection
    15969 (Ifna6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15969 (Ifna6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15969 (Ifna6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15969 (Ifna6)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15969 (Ifna6)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15969
NCBI-ProteinID: NP_996754
MGI: 107662
Ensembl: ENSMUSG00000101252
Vega: OTTMUSG00000011288
UniProt: Q810G5
Position
4 C4; 4 42.03 cM
AA seq 189 aa
MARLCAFLMVLVVLSYWSTCSLGCDLPQTHNLRNKKALTLLVQMRRLSPLSCLKDRKDFG
FPLEKVDAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLK
ACVMQEVGVQESPLTQEDSLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEDE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggttttggtggtgttgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagaaagccttgacactc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttccccttggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg
actgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcatgg
aatgcaaccctcctagactcattctgcaatgacctccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaggaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggacatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagactgagtgaggacgagtga

KEGG   Mus musculus (mouse): 15970
Entry
15970             CDS       T01002                                 

Gene name
Ifna7, If, Ifa7
Definition
(RefSeq) interferon alpha 7
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15970 (Ifna7)
   04151 PI3K-Akt signaling pathway
    15970 (Ifna7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15970 (Ifna7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15970 (Ifna7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15970 (Ifna7)
   04621 NOD-like receptor signaling pathway
    15970 (Ifna7)
   04622 RIG-I-like receptor signaling pathway
    15970 (Ifna7)
   04623 Cytosolic DNA-sensing pathway
    15970 (Ifna7)
   04650 Natural killer cell mediated cytotoxicity
    15970 (Ifna7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15970 (Ifna7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15970 (Ifna7)
   05161 Hepatitis B
    15970 (Ifna7)
   05160 Hepatitis C
    15970 (Ifna7)
   05171 Coronavirus disease - COVID-19
    15970 (Ifna7)
   05164 Influenza A
    15970 (Ifna7)
   05162 Measles
    15970 (Ifna7)
   05168 Herpes simplex virus 1 infection
    15970 (Ifna7)
   05163 Human cytomegalovirus infection
    15970 (Ifna7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15970 (Ifna7)
   05169 Epstein-Barr virus infection
    15970 (Ifna7)
   05165 Human papillomavirus infection
    15970 (Ifna7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15970 (Ifna7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15970 (Ifna7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15970 (Ifna7)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15970 (Ifna7)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15970
NCBI-ProteinID: NP_032360
MGI: 107661
Ensembl: ENSMUSG00000100713
Vega: OTTMUSG00000011286
UniProt: Q810G6
Position
4 C4; 4 42.03 cM
AA seq 190 aa
MARLCAFLMVLVVLSYWPTCSLGYDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFR
FPQEKVDAQQIQEAQALCVLHELTQQILNIFTSKDSSAAWDGSLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEPPLTQEDALLAVRTYFHSITVFLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEKKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggtcctggtggtgttgagctactggccaacctgc
tctctaggatatgaccttcctcagactcataacctcaggaacaagagagccttaaccctc
ctggtaaaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttaga
ttcccccaggagaaggtggatgcccagcagatccaggaggctcaagccctctgtgttctg
catgagctgacccagcagatcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatggatccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggaacctcctctgacccaggaagatgccctg
ctggctgtgaggacatacttccacagcatcactgtgttcctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagattgagtgagaagaaggagtga

KEGG   Mus musculus (mouse): 15972
Entry
15972             CDS       T01002                                 

Gene name
Ifna9, If, Ifa9
Definition
(RefSeq) interferon alpha 9
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15972 (Ifna9)
   04151 PI3K-Akt signaling pathway
    15972 (Ifna9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15972 (Ifna9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15972 (Ifna9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15972 (Ifna9)
   04621 NOD-like receptor signaling pathway
    15972 (Ifna9)
   04622 RIG-I-like receptor signaling pathway
    15972 (Ifna9)
   04623 Cytosolic DNA-sensing pathway
    15972 (Ifna9)
   04650 Natural killer cell mediated cytotoxicity
    15972 (Ifna9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15972 (Ifna9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15972 (Ifna9)
   05161 Hepatitis B
    15972 (Ifna9)
   05160 Hepatitis C
    15972 (Ifna9)
   05171 Coronavirus disease - COVID-19
    15972 (Ifna9)
   05164 Influenza A
    15972 (Ifna9)
   05162 Measles
    15972 (Ifna9)
   05168 Herpes simplex virus 1 infection
    15972 (Ifna9)
   05163 Human cytomegalovirus infection
    15972 (Ifna9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15972 (Ifna9)
   05169 Epstein-Barr virus infection
    15972 (Ifna9)
   05165 Human papillomavirus infection
    15972 (Ifna9)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15972 (Ifna9)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15972 (Ifna9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15972 (Ifna9)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15972 (Ifna9)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15972
NCBI-ProteinID: NP_034637
MGI: 107659
Ensembl: ENSMUSG00000095270
Vega: OTTMUSG00000007667
UniProt: P09235
Position
4 C4; 4 42.01 cM
AA seq 190 aa
MARPFAFLMVLVVISYWSTCSLGCDLPQTHNLRNKKILTLLAQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQEAQAIPVLSELTQQILTLFTSKDSSAAWNATLLDSFCTGLHQLLNDLQ
GCLMQLVGMKELPLTQEDSQLAMKKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVN
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggccctttgctttcctgatggtcttggtggtgataagctactggtcaacctgc
tctctaggatgtgacctgcctcaaactcataacctcaggaacaagaaaatcttgacactc
ctggcacaaatgaggagactctcccctctctcttgcctgaaggacagaaaggactttgga
ttcccccaggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg
agtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcactggcctccaccagctgctcaatgacctgcaa
ggctgtctgatgcagctggtcgggatgaaggaactgcccctgacccaggaagactcccag
ctggctatgaagaaatatttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagttaac
ttgctggcaagactgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 15974
Entry
15974             CDS       T01002                                 

Gene name
Ifnab
Definition
(RefSeq) interferon alpha B
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15974 (Ifnab)
   04151 PI3K-Akt signaling pathway
    15974 (Ifnab)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15974 (Ifnab)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15974 (Ifnab)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15974 (Ifnab)
   04621 NOD-like receptor signaling pathway
    15974 (Ifnab)
   04622 RIG-I-like receptor signaling pathway
    15974 (Ifnab)
   04623 Cytosolic DNA-sensing pathway
    15974 (Ifnab)
   04650 Natural killer cell mediated cytotoxicity
    15974 (Ifnab)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15974 (Ifnab)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15974 (Ifnab)
   05161 Hepatitis B
    15974 (Ifnab)
   05160 Hepatitis C
    15974 (Ifnab)
   05171 Coronavirus disease - COVID-19
    15974 (Ifnab)
   05164 Influenza A
    15974 (Ifnab)
   05162 Measles
    15974 (Ifnab)
   05168 Herpes simplex virus 1 infection
    15974 (Ifnab)
   05163 Human cytomegalovirus infection
    15974 (Ifnab)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15974 (Ifnab)
   05169 Epstein-Barr virus infection
    15974 (Ifnab)
   05165 Human papillomavirus infection
    15974 (Ifnab)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15974 (Ifnab)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15974 (Ifnab)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15974 (Ifnab)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15974 (Ifnab)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15974
NCBI-ProteinID: NP_032362
MGI: 1097683
Ensembl: ENSMUSG00000100079
Vega: OTTMUSG00000011271
UniProt: Q61719 L7MTU6
Position
4; 4 C4
AA seq 190 aa
MARLSTFLMVLAVMSYWSTCPLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQEAQAIPVLTELTQQMLTLFTSKASSAAWNATLLDSFCNDLHQQLNDLK
TCLMQEVGVQESPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLASLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctcagcactttcctaatggtcctggcagtgatgagctactggtcaacctgc
cctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgacactc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggacttcgga
ttcccccaggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg
actgagctgacccagcagatgctgaccctcttcacatcaaaggcttcatctgctgcttgg
aatgcaaccctactagactcattctgcaatgacctccaccagcaactcaatgacctgaaa
acctgtctgatgcaggaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacagcatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaagtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagtctgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 15977
Entry
15977             CDS       T01002                                 

Gene name
Ifnb1, IFN-b, IFN-beta, IFNB, If, Ifb
Definition
(RefSeq) interferon beta 1, fibroblast
  KO
K05415  interferon beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04668  TNF signaling pathway
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15977 (Ifnb1)
   04668 TNF signaling pathway
    15977 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    15977 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15977 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15977 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15977 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    15977 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    15977 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    15977 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    15977 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15977 (Ifnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15977 (Ifnb1)
   05161 Hepatitis B
    15977 (Ifnb1)
   05160 Hepatitis C
    15977 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    15977 (Ifnb1)
   05164 Influenza A
    15977 (Ifnb1)
   05162 Measles
    15977 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    15977 (Ifnb1)
   05163 Human cytomegalovirus infection
    15977 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15977 (Ifnb1)
   05169 Epstein-Barr virus infection
    15977 (Ifnb1)
   05165 Human papillomavirus infection
    15977 (Ifnb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    15977 (Ifnb1)
   05152 Tuberculosis
    15977 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    15977 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15977 (Ifnb1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15977 (Ifnb1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15977
NCBI-ProteinID: NP_034640
MGI: 107657
Ensembl: ENSMUSG00000048806
Vega: OTTMUSG00000007654
UniProt: P01575 Q0VE17
Structure
PDB: 
1WU3 1IFA 3WCY

Position
4 C4; 4 41.91 cM
AA seq 182 aa
MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIP
MEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLE
EKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNF
QN
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaacaacaggtggatcctccacgctgcgttcctgctgtgcttctccaccacagccctc
tccatcaactataagcagctccagctccaagaaaggacgaacattcggaaatgtcaggag
ctcctggagcagctgaatggaaagatcaacctcacctacagggcggacttcaagatccct
atggagatgacggagaagatgcagaagagttacactgcctttgccatccaagagatgctc
cagaatgtctttcttgtcttcagaaacaatttctccagcactgggtggaatgagactatt
gttgtacgtctcctggatgaactccaccagcagacagtgtttctgaagacagtactagag
gaaaagcaagaggaaagattgacgtgggagatgtcctcaactgctctccacttgaagagc
tattactggagggtgcaaaggtaccttaaactcatgaagtacaacagctacgcctggatg
gtggtccgagcagagatcttcaggaactttctcatcattcgaagacttaccagaaacttc
caaaactga

KEGG   Mus musculus (mouse): 16183
Entry
16183             CDS       T01002                                 

Gene name
Il2, IL, Il-2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04151  PI3K-Akt signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16183 (Il2)
   04151 PI3K-Akt signaling pathway
    16183 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16183 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16183 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    16183 (Il2)
   04660 T cell receptor signaling pathway
    16183 (Il2)
   04658 Th1 and Th2 cell differentiation
    16183 (Il2)
   04659 Th17 cell differentiation
    16183 (Il2)
   04672 Intestinal immune network for IgA production
    16183 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16183 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16183 (Il2)
   05171 Coronavirus disease - COVID-19
    16183 (Il2)
   05162 Measles
    16183 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16183 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    16183 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    16183 (Il2)
   05321 Inflammatory bowel disease
    16183 (Il2)
   05330 Allograft rejection
    16183 (Il2)
   05332 Graft-versus-host disease
    16183 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    16183 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16183 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16183 (Il2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16183 (Il2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Cytokines
   16183 (Il2)
SSDB
Motif
Pfam: IL2 DivIC RSF DUF773 FlaG
Other DBs
NCBI-GeneID: 16183
NCBI-ProteinID: NP_032392
MGI: 96548
Ensembl: ENSMUSG00000027720
Vega: OTTMUSG00000007347
UniProt: P04351
Structure
PDB: 
4YUE 4YQX

Position
3 B; 3 18.3 cM
AA seq 169 aa
MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLS
RMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENF
ISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtacagcatgcagctcgcatcctgtgtcacattgacacttgtgctccttgtcaacagc
gcacccacttcaagctccacttcaagctctacagcggaagcacagcagcagcagcagcag
cagcagcagcagcagcagcacctggagcagctgttgatggacctacaggagctcctgagc
aggatggagaattacaggaacctgaaactccccaggatgctcaccttcaaattttacttg
cccaagcaggccacagaattgaaagatcttcagtgcctagaagatgaacttggacctctg
cggcatgttctggatttgactcaaagcaaaagctttcaattggaagatgctgagaatttc
atcagcaatatcagagtaactgttgtaaaactaaagggctctgacaacacatttgagtgc
caattcgatgatgagtcagcaactgtggtggactttctgaggagatggatagccttctgt
caaagcatcatctcaacaagccctcaataa

KEGG   Mus musculus (mouse): 16187
Entry
16187             CDS       T01002                                 

Gene name
Il3, B, BPA, Csfm, Csfmu, HCGF, Il, Il-3, MCGF, P, PSF
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04664  Fc epsilon RI signaling pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05310  Asthma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16187 (Il3)
   04151 PI3K-Akt signaling pathway
    16187 (Il3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16187 (Il3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    16187 (Il3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16187 (Il3)
   04664 Fc epsilon RI signaling pathway
    16187 (Il3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16187 (Il3)
   05202 Transcriptional misregulation in cancer
    16187 (Il3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    16187 (Il3)
  09163 Immune disease
   05310 Asthma
    16187 (Il3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16187 (Il3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16187 (Il3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16187 (Il3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Cytokines
   16187 (Il3)
SSDB
Motif
Pfam: IL3 DUF4635
Other DBs
NCBI-GeneID: 16187
NCBI-ProteinID: NP_034686
MGI: 96552
Ensembl: ENSMUSG00000018914
Vega: OTTMUSG00000005664
UniProt: P01586 Q5SX77
Structure
PDB: 
2L3O

Position
11 B1.3; 11 32.13 cM
AA seq 166 aa
MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELK
TDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVF
IRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
NT seq 501 nt   +upstreamnt  +downstreamnt
atggttcttgccagctctaccaccagcatccacaccatgctgctcctgctcctgatgctc
ttccacctgggactccaagcttcaatcagtggccgggatacccaccgtttaaccagaacg
ttgaattgcagctctattgtcaaggagattatagggaagctcccagaacctgaactcaaa
actgatgatgaaggaccctctctgaggaataagagctttcggagagtaaacctgtccaaa
ttcgtggaaagccaaggagaagtggatcctgaggacagatacgttatcaagtccaatctt
cagaaacttaactgttgcctgcctacatctgcgaatgactctgcgctgccaggggtcttc
attcgagatctggatgactttcggaagaaactgagattctacatggtccaccttaacgat
ctggagacagtgctaacctctagaccacctcagcccgcatctggctccgtctctcctaac
cgtggaaccgtggaatgttaa

KEGG   Mus musculus (mouse): 16189
Entry
16189             CDS       T01002                                 

Gene name
Il4, BSF-1, Il, Il-4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05140  Leishmaniasis
mmu05200  Pathways in cancer
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease
mmu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16189 (Il4)
   04151 PI3K-Akt signaling pathway
    16189 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16189 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16189 (Il4)
   04660 T cell receptor signaling pathway
    16189 (Il4)
   04658 Th1 and Th2 cell differentiation
    16189 (Il4)
   04659 Th17 cell differentiation
    16189 (Il4)
   04657 IL-17 signaling pathway
    16189 (Il4)
   04664 Fc epsilon RI signaling pathway
    16189 (Il4)
   04672 Intestinal immune network for IgA production
    16189 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16189 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    16189 (Il4)
  09163 Immune disease
   05310 Asthma
    16189 (Il4)
   05320 Autoimmune thyroid disease
    16189 (Il4)
   05321 Inflammatory bowel disease
    16189 (Il4)
   05330 Allograft rejection
    16189 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16189 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16189 (Il4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16189 (Il4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Cytokines
   16189 (Il4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 16189
NCBI-ProteinID: NP_067258
MGI: 96556
Ensembl: ENSMUSG00000000869
Vega: OTTMUSG00000005642
UniProt: P07750
Position
11 B1.3; 11 31.97 cM
AA seq 140 aa
MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATK
NTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESK
STSLKDFLESLKSIMQMDYS
NT seq 423 nt   +upstreamnt  +downstreamnt
atgggtctcaacccccagctagttgtcatcctgctcttctttctcgaatgtaccaggagc
catatccacggatgcgacaaaaatcacttgagagagatcatcggcattttgaacgaggtc
acaggagaagggacgccatgcacggagatggatgtgccaaacgtcctcacagcaacgaag
aacaccacagagagtgagctcgtctgtagggcttccaaggtgcttcgcatattttattta
aaacatgggaaaactccatgcttgaagaagaactctagtgttctcatggagctgcagaga
ctctttcgggcttttcgatgcctggattcatcgataagctgcaccatgaatgagtccaag
tccacatcactgaaagacttcctggaaagcctaaagagcatcatgcaaatggattactcg
tag

KEGG   Mus musculus (mouse): 16193
Entry
16193             CDS       T01002                                 

Gene name
Il6, Il, Il-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01523  Antifolate resistance
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu04659  Th17 cell differentiation
mmu04668  TNF signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05321  Inflammatory bowel disease
mmu05323  Rheumatoid arthritis
mmu05332  Graft-versus-host disease
mmu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16193 (Il6)
   04668 TNF signaling pathway
    16193 (Il6)
   04066 HIF-1 signaling pathway
    16193 (Il6)
   04068 FoxO signaling pathway
    16193 (Il6)
   04151 PI3K-Akt signaling pathway
    16193 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16193 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16193 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    16193 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16193 (Il6)
   04620 Toll-like receptor signaling pathway
    16193 (Il6)
   04621 NOD-like receptor signaling pathway
    16193 (Il6)
   04623 Cytosolic DNA-sensing pathway
    16193 (Il6)
   04625 C-type lectin receptor signaling pathway
    16193 (Il6)
   04659 Th17 cell differentiation
    16193 (Il6)
   04657 IL-17 signaling pathway
    16193 (Il6)
   04672 Intestinal immune network for IgA production
    16193 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16193 (Il6)
   05202 Transcriptional misregulation in cancer
    16193 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16193 (Il6)
   05161 Hepatitis B
    16193 (Il6)
   05171 Coronavirus disease - COVID-19
    16193 (Il6)
   05164 Influenza A
    16193 (Il6)
   05162 Measles
    16193 (Il6)
   05168 Herpes simplex virus 1 infection
    16193 (Il6)
   05163 Human cytomegalovirus infection
    16193 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16193 (Il6)
   05169 Epstein-Barr virus infection
    16193 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16193 (Il6)
   05135 Yersinia infection
    16193 (Il6)
   05133 Pertussis
    16193 (Il6)
   05134 Legionellosis
    16193 (Il6)
   05152 Tuberculosis
    16193 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16193 (Il6)
   05144 Malaria
    16193 (Il6)
   05142 Chagas disease
    16193 (Il6)
   05143 African trypanosomiasis
    16193 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16193 (Il6)
   05321 Inflammatory bowel disease
    16193 (Il6)
   05332 Graft-versus-host disease
    16193 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16193 (Il6)
   05020 Prion disease
    16193 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    16193 (Il6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16193 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    16193 (Il6)
   04931 Insulin resistance
    16193 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16193 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16193 (Il6)
   01523 Antifolate resistance
    16193 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16193 (Il6)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16193 (Il6)
SSDB
Motif
Pfam: IL6 IL23
Other DBs
NCBI-GeneID: 16193
NCBI-ProteinID: NP_112445
MGI: 96559
Ensembl: ENSMUSG00000025746
Vega: OTTMUSG00000054480
UniProt: P08505 A2RTD1
Structure
PDB: 
2L3Y

Position
5 B1; 5 15.7 cM
AA seq 211 aa
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLW
EIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEY
HSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLES
QKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg
acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggataccact
cccaacagacctgtctataccacttcacaagtcggaggcttaattacacatgttctctgg
gaaatcgtggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacaacgat
gatgcacttgcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgctac
caaactggatataatcaggaaatttgcctattgaaaatttcctctggtcttctggagtac
catagctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga
gtccttcagagagatacagaaactctaattcatatcttcaaccaagaggtaaaagattta
cataaaatagtccttcctaccccaatttccaatgctctcctaacagataagctggagtca
cagaaggagtggctaaggaccaagaccatccaattcatcttgaaatcacttgaagaattt
ctaaaagtcactttgagatctactcggcaaacctag

KEGG   Mus musculus (mouse): 16196
Entry
16196             CDS       T01002                                 

Gene name
Il7, A630026I06Rik, Il, Il-7, hlb36, hlb368
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16196 (Il7)
   04151 PI3K-Akt signaling pathway
    16196 (Il7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16196 (Il7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16196 (Il7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16196 (Il7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16196 (Il7)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16196 (Il7)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16196 (Il7)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Cytokines
   16196 (Il7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 16196
NCBI-ProteinID: NP_032397
MGI: 96561
Ensembl: ENSMUSG00000040329
Vega: OTTMUSG00000051379
UniProt: P10168 Q544C8
Position
3 A1; 3 2.02 cM
AA seq 154 aa
MFHVSFRYIFGIPPLILVLLPVTSSECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPN
NEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKE
EKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
NT seq 465 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttagatatatctttggaattcctccactgatccttgttctgctg
cctgtcacatcatctgagtgccacattaaagacaaagaaggtaaagcatatgagagtgta
ctgatgatcagcatcgatgaattggacaaaatgacaggaactgatagtaattgcccgaat
aatgaaccaaacttttttagaaaacatgtatgtgatgatacaaaggaagctgcttttcta
aatcgtgctgctcgcaagttgaagcaatttcttaaaatgaatatcagtgaagaattcaat
gtccacttactaacagtatcacaaggcacacaaacactggtgaactgcacaagtaaggaa
gaaaaaaacgtaaaggaacagaaaaagaatgatgcatgtttcctaaagagactactgaga
gaaataaaaacttgttggaataaaattttgaagggcagtatataa

KEGG   Mus musculus (mouse): 18413
Entry
18413             CDS       T01002                                 

Gene name
Osm, On, OncoM
Definition
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    18413 (Osm)
   04151 PI3K-Akt signaling pathway
    18413 (Osm)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18413 (Osm)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18413 (Osm)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   18413 (Osm)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 18413
NCBI-ProteinID: NP_001013383
MGI: 104749
Ensembl: ENSMUSG00000058755
Vega: OTTMUSG00000005054
UniProt: P53347
Position
11 A1; 11 2.94 cM
AA seq 263 aa
MQTRLLRTLLSLTLSLLILSMALANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQ
NLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAF
PKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFL
WGYHRFMGSVGRVFREWDDGSTRSRRQSPLRARRKGTRRIRVRHKGTRRIRVRRKGTRRI
WVRRKGSRKIRPSRSTQSPTTRA
NT seq 792 nt   +upstreamnt  +downstreamnt
atgcagacacggcttctaagaacactgctcagtttgaccctcagtctcctcatcctgagc
atggcactggccaatcgtggctgctccaactcttcctctcagctcctcagccagctgcag
aatcaggcgaacctcacggggaacacagaatcactcttggagccctatatccgcctccaa
aacctgaacacacctgacctgagagctgcctgcacccagcactctgtggccttccccagt
gaggacacactccggcaactgagcaagcctcacttcctgagcactgtgtacaccacactg
gacagagtcttgtaccaactggatgctttaagacagaaatttctgaagactccggctttt
ccaaagctggacagtgcccggcacaatatcctcggcataaggaacaatgttttctgcatg
gcccggctgctcaaccactccctggagatacctgagcccacacagacagactctggggcc
tcacggtccactacaacaccagatgtctttaataccaagataggcagctgtggctttctc
tggggataccatcgcttcatgggctcagtggggagggtcttcagggaatgggacgatggc
tccacacgcagccggagacagagcccgctccgggcccggcgcaagggaacccgcagaatc
cgggtccggcacaagggaacccgcagaatccgggtccggcgcaagggaacccgcagaatc
tgggtccggcgcaagggatcccgcaaaatcagaccttccaggagcacccagagcccgacg
accagggcctag

KEGG   Mus musculus (mouse): 19109
Entry
19109             CDS       T01002                                 

Gene name
Prl, AV290867, Gha1, Pr, Prl1a1
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    19109 (Prl)
   04151 PI3K-Akt signaling pathway
    19109 (Prl)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19109 (Prl)
   04060 Cytokine-cytokine receptor interaction
    19109 (Prl)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    19109 (Prl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    19109 (Prl)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   19109 (Prl)
SSDB
Motif
Pfam: Hormone_1 Noelin-1
Other DBs
NCBI-GeneID: 19109
NCBI-ProteinID: NP_001157002
MGI: 97762
Ensembl: ENSMUSG00000021342
Vega: OTTMUSG00000000731
UniProt: Q3TT66
Position
13 A3.1; 13 12.25 cM
AA seq 227 aa
MTMNSQGSAQKGTLLLLLISNLLFCQNVQPLPICSAGDCQTSLRELFDRVVILSHYIHTL
YTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSS
DPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQ
LPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaccatgaacagccaggggtcagcccagaaagggacactcctcctgttgctgatatca
aacctgctgttctgccaaaatgttcagcctctgccaatctgttccgctggtgactgccag
acttctctccgagagctgtttgaccgtgtggtcatactttctcactacatccataccctg
tatacagatatgttcattgaattcgataaacagtatgtgcaagaccgtgagtttatggtc
aaggtcatcaatgactgccccacttcttccctggctacacctgaagacaaggaacaagcc
ctgaaagtccctccggaagttcttctgaacctgatcctcagtttggtgcagtcctcgagt
gaccctctgtttcaactaataactggagtaggtggtattcaagaagcccccgaatacatc
ctatcaagagccaaagagattgaggaacaaaacaagcagcttcttgagggagttgagaag
ataattagccaggcctatcctgaagccaaaggaaatgggatctactttgtttggtcacaa
cttccatccctacagggagttgatgaagaatccaaaatcttgtctttgcgcaacaccatt
cgctgcctgcgcagggattcccacaaggttgacaattttctcaaggtcctgaggtgccaa
attgcccatcaaaacaactgctaa

KEGG   Mus musculus (mouse): 19111
Entry
19111             CDS       T01002                                 

Gene name
Prl6a1, Ghd10, P, PL, PLP-B, Prlpb
Definition
(RefSeq) prolactin family 6, subfamily a, member 1
  KO
K05439  prolactin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    19111 (Prl6a1)
   04151 PI3K-Akt signaling pathway
    19111 (Prl6a1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19111 (Prl6a1)
   04060 Cytokine-cytokine receptor interaction
    19111 (Prl6a1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    19111 (Prl6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    19111 (Prl6a1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   19111 (Prl6a1)
SSDB
Motif
Pfam: Hormone_1 Rbsn
Other DBs
NCBI-GeneID: 19111
NCBI-ProteinID: NP_035296
MGI: 1206579
Ensembl: ENSMUSG00000069259
Vega: OTTMUSG00000000636
UniProt: O35257 A0A0M6L0L9
Position
13 A3.1; 13 12.39 cM
AA seq 230 aa
MLSLSQPCFSGTLLMLLASNFLLWKNVAPVPMYASLDEYGEMSIYDLLDHVTILSHNVSE
LTAEMHRIFMEDVRYKPGRWFSDRYLTACHTSTLTISVSKEGARQMPGVFLVKEMISMLT
AWRYPLYHIITELSYMEQAPDEIISRARNIEEKIIVLIEALRGILSKIQPGPPENERYPV
WNELASLQSPDEDLRHLTLFNLFQCLVKDSRKIDSSIRLLKCKLLYNRDC
NT seq 693 nt   +upstreamnt  +downstreamnt
atgctgtctttgagtcaaccttgcttctcagggactctcctgatgctgttggcatcaaac
ttccttctgtggaagaatgtggcccctgtgcccatgtatgccagtttggatgaatatggt
gagatgtccatatatgacctgcttgatcacgtcaccatactatctcataatgtcagtgag
ctcactgcagaaatgcacaggatatttatggaggatgtgcgatataaaccaggcaggtgg
ttctctgacagataccttactgcctgccacacatctacattgactatttcagtgtctaag
gagggagcccgacagatgccgggtgtattccttgtgaaagagatgatcagtatgttgaca
gcttggagatatcctctgtatcacataataactgaactgagttatatggagcaagctcca
gatgagatcatatcaagagccagaaatattgaagaaaaaatcatagtacttatagaagct
cttagagggatactcagcaagattcagcctggacccccagaaaatgagagatatcccgtg
tggaatgaactggcatccttgcagtcacctgatgaagaccttcgccatcttacattattt
aacttattccagtgcttggtcaaggattcacgtaagattgactctagtatcaggcttttg
aagtgcaaacttctctataacagagattgttaa

KEGG   Mus musculus (mouse): 230396
Entry
230396            CDS       T01002                                 

Gene name
Ifna13
Definition
(RefSeq) interferon alpha 13
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    230396 (Ifna13)
   04151 PI3K-Akt signaling pathway
    230396 (Ifna13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    230396 (Ifna13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    230396 (Ifna13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    230396 (Ifna13)
   04621 NOD-like receptor signaling pathway
    230396 (Ifna13)
   04622 RIG-I-like receptor signaling pathway
    230396 (Ifna13)
   04623 Cytosolic DNA-sensing pathway
    230396 (Ifna13)
   04650 Natural killer cell mediated cytotoxicity
    230396 (Ifna13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    230396 (Ifna13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    230396 (Ifna13)
   05161 Hepatitis B
    230396 (Ifna13)
   05160 Hepatitis C
    230396 (Ifna13)
   05171 Coronavirus disease - COVID-19
    230396 (Ifna13)
   05164 Influenza A
    230396 (Ifna13)
   05162 Measles
    230396 (Ifna13)
   05168 Herpes simplex virus 1 infection
    230396 (Ifna13)
   05163 Human cytomegalovirus infection
    230396 (Ifna13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    230396 (Ifna13)
   05169 Epstein-Barr virus infection
    230396 (Ifna13)
   05165 Human papillomavirus infection
    230396 (Ifna13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    230396 (Ifna13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    230396 (Ifna13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    230396 (Ifna13)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   230396 (Ifna13)
SSDB
Motif
Pfam: Interferon RIX1
Other DBs
NCBI-GeneID: 230396
NCBI-ProteinID: NP_796321
MGI: 2667155
Ensembl: ENSMUSG00000063376
Vega: OTTMUSG00000011277
UniProt: Q80SU4
Position
4 C4; 4 42.02 cM
AA seq 189 aa
MARPCAFLMVLVVLSYWSACSLGCDLPQTHNLRNKRALTLLEQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATLLDSFCNDLHQQLNDLK
ACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVQRTLSSSAN
LLARLSKEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccttgtgctttcctgatggttttggtggtgttgagctactggtcagcctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgactctc
ctggaacaaatgaggagactctcccctctttcctgtctgaaggacagaaaggactttgga
ttcccacaggagaaggtggatgcccagcagatcaagaaggctcaagccatcccttttgtt
catgagctgacccagcagatcctgaccctcttcacatcaaatgactcatctgctgcatgg
aatgcaaccctcctagactcattctgcaatgacctccatcagcagctcaatgacctcaaa
gcttgtctgatgcagcaggttggggtgcaggaatttcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacagcatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtccagagaaccctgtcttcctcagccaac
ttgctggcaagactgagcaaggaggagtga

KEGG   Mus musculus (mouse): 230398
Entry
230398            CDS       T01002                                 

Gene name
Ifna16, BC114392, Gm13280, Ifn, Ifna6T, Ifnat6
Definition
(RefSeq) interferon alpha 16
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    230398 (Ifna16)
   04151 PI3K-Akt signaling pathway
    230398 (Ifna16)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    230398 (Ifna16)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    230398 (Ifna16)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    230398 (Ifna16)
   04621 NOD-like receptor signaling pathway
    230398 (Ifna16)
   04622 RIG-I-like receptor signaling pathway
    230398 (Ifna16)
   04623 Cytosolic DNA-sensing pathway
    230398 (Ifna16)
   04650 Natural killer cell mediated cytotoxicity
    230398 (Ifna16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    230398 (Ifna16)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    230398 (Ifna16)
   05161 Hepatitis B
    230398 (Ifna16)
   05160 Hepatitis C
    230398 (Ifna16)
   05171 Coronavirus disease - COVID-19
    230398 (Ifna16)
   05164 Influenza A
    230398 (Ifna16)
   05162 Measles
    230398 (Ifna16)
   05168 Herpes simplex virus 1 infection
    230398 (Ifna16)
   05163 Human cytomegalovirus infection
    230398 (Ifna16)
   05167 Kaposi sarcoma-associated herpesvirus infection
    230398 (Ifna16)
   05169 Epstein-Barr virus infection
    230398 (Ifna16)
   05165 Human papillomavirus infection
    230398 (Ifna16)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    230398 (Ifna16)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    230398 (Ifna16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    230398 (Ifna16)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   230398 (Ifna16)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 230398
NCBI-ProteinID: NP_996750
MGI: 3649260
Ensembl: ENSMUSG00000078355
Vega: OTTMUSG00000011275
UniProt: Q810G1
Position
4 C4; 4
AA seq 189 aa
MARLCAFLMVLAVMSYWSTCSLGCDLPQTHKLRNKRALTLLIQMRRLSPLSCLKDRKDFG
FPQEKVDTLKIQKEKAIPVLSEVTQQILNIFTSKDSSAAWDATLLDTFCNDLYQQLNDLQ
ACLVQQVRLQEPPLTQEVSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggttctggctgtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataaactcaggaacaagagagccttgacactc
ttgatacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggataccctgaagatccagaaagagaaagccatccctgtccta
agtgaggtgacccagcagatcctgaacatcttcacatcaaaggattcatctgctgcttgg
gatgcaaccctcctagatacattttgtaatgacctctaccagcagctcaatgacctgcaa
gcctgtctagtgcagcaggtgaggttgcaggaacctcctctgacccaggaagtctccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctctgccaat
gtgctgggaagactgagagaagagaaatga

KEGG   Mus musculus (mouse): 242517
Entry
242517            CDS       T01002                                 

Gene name
Ifna15, Gm12597, I, Ifnaa, MuIFN-alpha-A
Definition
(RefSeq) interferon alpha 15
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    242517 (Ifna15)
   04151 PI3K-Akt signaling pathway
    242517 (Ifna15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    242517 (Ifna15)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    242517 (Ifna15)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    242517 (Ifna15)
   04621 NOD-like receptor signaling pathway
    242517 (Ifna15)
   04622 RIG-I-like receptor signaling pathway
    242517 (Ifna15)
   04623 Cytosolic DNA-sensing pathway
    242517 (Ifna15)
   04650 Natural killer cell mediated cytotoxicity
    242517 (Ifna15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    242517 (Ifna15)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    242517 (Ifna15)
   05161 Hepatitis B
    242517 (Ifna15)
   05160 Hepatitis C
    242517 (Ifna15)
   05171 Coronavirus disease - COVID-19
    242517 (Ifna15)
   05164 Influenza A
    242517 (Ifna15)
   05162 Measles
    242517 (Ifna15)
   05168 Herpes simplex virus 1 infection
    242517 (Ifna15)
   05163 Human cytomegalovirus infection
    242517 (Ifna15)
   05167 Kaposi sarcoma-associated herpesvirus infection
    242517 (Ifna15)
   05169 Epstein-Barr virus infection
    242517 (Ifna15)
   05165 Human papillomavirus infection
    242517 (Ifna15)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    242517 (Ifna15)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    242517 (Ifna15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    242517 (Ifna15)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   242517 (Ifna15)
SSDB
Motif
Pfam: Interferon APC1_C DUF4569
Other DBs
NCBI-GeneID: 242517
NCBI-ProteinID: NP_996753
MGI: 3649418
Ensembl: ENSMUSG00000096011
Vega: OTTMUSG00000007655
UniProt: Q61718
Position
4; 4 C4
AA seq 190 aa
MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFR
FPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLK
ACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAK
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatgaccctgctagtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgaccctc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttaga
ttcccccaggagaaggtggatgcccagcagatccagaatgctcaagccatccctgtccta
caagagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcatccctcctagactcattctgcaatgacctccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaggaggtgggggtgcaggaacctcccctgacccaggaagactacctg
ctggctgtgaggacatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccatgtcttcctcagccaag
ttgctggcaagactgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 242519
Entry
242519            CDS       T01002                                 

Gene name
Ifna12
Definition
(RefSeq) interferon alpha 12
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    242519 (Ifna12)
   04151 PI3K-Akt signaling pathway
    242519 (Ifna12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    242519 (Ifna12)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    242519 (Ifna12)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    242519 (Ifna12)
   04621 NOD-like receptor signaling pathway
    242519 (Ifna12)
   04622 RIG-I-like receptor signaling pathway
    242519 (Ifna12)
   04623 Cytosolic DNA-sensing pathway
    242519 (Ifna12)
   04650 Natural killer cell mediated cytotoxicity
    242519 (Ifna12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    242519 (Ifna12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    242519 (Ifna12)
   05161 Hepatitis B
    242519 (Ifna12)
   05160 Hepatitis C
    242519 (Ifna12)
   05171 Coronavirus disease - COVID-19
    242519 (Ifna12)
   05164 Influenza A
    242519 (Ifna12)
   05162 Measles
    242519 (Ifna12)
   05168 Herpes simplex virus 1 infection
    242519 (Ifna12)
   05163 Human cytomegalovirus infection
    242519 (Ifna12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    242519 (Ifna12)
   05169 Epstein-Barr virus infection
    242519 (Ifna12)
   05165 Human papillomavirus infection
    242519 (Ifna12)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    242519 (Ifna12)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    242519 (Ifna12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    242519 (Ifna12)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   242519 (Ifna12)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 242519
NCBI-ProteinID: NP_796335
MGI: 2676324
Ensembl: ENSMUSG00000073811
Vega: OTTMUSG00000007663
UniProt: Q80SS5
Position
4; 4 C4
AA seq 189 aa
MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLAQMRRLSPLSCLKDRKNFR
FPQEKVDAQQIKKAQVIPVLSELTQQILTLFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRTLSSSAK
LLARLSEKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatgaccctgctagtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgactctc
ctggcacaaatgaggagactctcccctctctcctgcctgaaggacagaaagaactttaga
ttcccccaggagaaggtggatgcccagcagatcaagaaggctcaagtcatccctgtcctg
agtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcatgg
aatacaaccctcctagactcattctgcaatgacctccatcagcagctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggagcctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagaaccctgtcttcctcagctaag
ttgctggcaagactgagtgagaaggagtga

KEGG   Mus musculus (mouse): 28078
Entry
28078             CDS       T01002                                 

Gene name
Prl5a1, 1600013P04Rik, D13Wsu14, D13Wsu14e, Ghd24, P, PLP-L, Prlpl
Definition
(RefSeq) prolactin family 5, subfamily a, member 1
  KO
K05439  prolactin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    28078 (Prl5a1)
   04151 PI3K-Akt signaling pathway
    28078 (Prl5a1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    28078 (Prl5a1)
   04060 Cytokine-cytokine receptor interaction
    28078 (Prl5a1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    28078 (Prl5a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    28078 (Prl5a1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   28078 (Prl5a1)
SSDB
Motif
Pfam: Hormone_1 NPV_P10
Other DBs
NCBI-GeneID: 28078
NCBI-ProteinID: NP_076235
MGI: 106332
Ensembl: ENSMUSG00000017064
Vega: OTTMUSG00000000654
UniProt: Q9JII2 A0A0M6L0X8
Position
13 A3.1; 13 12.69 cM
AA seq 230 aa
MRLSKIQPHQSGTLLLLLLSNLLMWENVASVPRCIMEDGGCQKVLNYIFNMTSTISENFN
NLSSETLNDFDTEYDPHQKFQNRPTMTCHTSSRSVPNNKRKAERMRPVVLLNVTIRMLAA
WKNLLHHVENNMADLDGTPYVIISKVKLIDRQIKKLTKNLQNIKTILSQVNPDLKKNEDY
PAWSGEPYVQQSKRRVQLFGLHSLFFCLNNDAQKVSDFISILRDQIVPNQ
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcggctgtctaagattcaaccacaccaatcagggacacttctgctgctgctgctgtca
aacttgctcatgtgggagaatgtggcctctgtgcccagatgtatcatggaagatggaggt
tgccagaaggtcctcaactacatttttaacatgacaagcaccatatctgagaacttcaac
aacctttcttcagaaacattaaatgattttgatacagagtatgatccccaccagaaattc
cagaacaggcccaccatgacctgtcacacttcatcccgctctgtcccaaacaacaaaagg
aaggctgaaagaatgcggcctgtggtgcttctgaatgtgacaattagaatgctggctgcc
tggaaaaaccttctgcaccatgtagaaaacaacatggctgatctcgatggaactccttat
gttatcatatcaaaagttaagttgattgacagacaaatcaaaaaactcactaaaaatctg
cagaacattaagactatactcagccaggttaatcctgaccttaagaaaaatgaagactac
cctgcctggtcaggagagccatatgtacagcaatcaaaaaggagagttcaactttttggt
ttgcatagtttgtttttctgcttgaacaatgatgcacagaaggtttctgatttcatcagt
atcctgagagaccaaattgtgcctaatcaatga

KEGG   Mus musculus (mouse): 404549
Entry
404549            CDS       T01002                                 

Gene name
Ifna14
Definition
(RefSeq) interferon alpha 14
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    404549 (Ifna14)
   04151 PI3K-Akt signaling pathway
    404549 (Ifna14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    404549 (Ifna14)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    404549 (Ifna14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    404549 (Ifna14)
   04621 NOD-like receptor signaling pathway
    404549 (Ifna14)
   04622 RIG-I-like receptor signaling pathway
    404549 (Ifna14)
   04623 Cytosolic DNA-sensing pathway
    404549 (Ifna14)
   04650 Natural killer cell mediated cytotoxicity
    404549 (Ifna14)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    404549 (Ifna14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    404549 (Ifna14)
   05161 Hepatitis B
    404549 (Ifna14)
   05160 Hepatitis C
    404549 (Ifna14)
   05171 Coronavirus disease - COVID-19
    404549 (Ifna14)
   05164 Influenza A
    404549 (Ifna14)
   05162 Measles
    404549 (Ifna14)
   05168 Herpes simplex virus 1 infection
    404549 (Ifna14)
   05163 Human cytomegalovirus infection
    404549 (Ifna14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    404549 (Ifna14)
   05169 Epstein-Barr virus infection
    404549 (Ifna14)
   05165 Human papillomavirus infection
    404549 (Ifna14)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    404549 (Ifna14)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    404549 (Ifna14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    404549 (Ifna14)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   404549 (Ifna14)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 404549
NCBI-ProteinID: NP_996858
MGI: 3641425
Ensembl: ENSMUSG00000095896
Vega: OTTMUSG00000007662
UniProt: Q810G3
Position
4; 4 C4
AA seq 189 aa
MARLCAFLMTLLVMSYWSTCCLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPVLSELTQQILTLFTSKDSSAAWDATLLDSFCNDLNTQLNDLQ
GCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEIWRALSSSAK
LLTSLKEEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatgaccctgctggtgatgagctactggtcaacctgc
tgtctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgacactt
ctggtaaaaatgaggagactctcccctctctcctgcctgaaggaccggaaggactttgga
ttcccgcaggagaaggtggatgcccagcagatcaagaaggctcaagccatccctgtcctg
agtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
gatgcaaccctcctagactccttctgcaatgacctcaacactcagctcaatgacctgcaa
ggctgtctgatgcagcaggtagagatacaggcacctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtttacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaaatctggagagccctgtcttcctcagccaag
ttgctgaccagcctgaaagaagagaagtga

DBGET integrated database retrieval system