KEGG   Mus musculus (mouse): 12986
Entry
12986             CDS       T01002                                 

Gene name
Csf3r, Cd114, Csf, Csfgr, G-CS, G-CSF-R, G-CSFR
Definition
(RefSeq) colony stimulating factor 3 receptor (granulocyte)
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12986 (Csf3r)
   04151 PI3K-Akt signaling pathway
    12986 (Csf3r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12986 (Csf3r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12986 (Csf3r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12986 (Csf3r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12986 (Csf3r)
   04090 CD molecules [BR:mmu04090]
    12986 (Csf3r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   12986 (Csf3r)
CD molecules [BR:mmu04090]
 Proteins
  12986 (Csf3r)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig DUF3102
Other DBs
NCBI-GeneID: 12986
NCBI-ProteinID: NP_031808
MGI: 1339755
Ensembl: ENSMUSG00000028859
Vega: OTTMUSG00000009297
UniProt: P40223
Structure
PDB: 
1CD9 1PGR 1GCF 1CTO

Position
4 D2.2; 4 59.77 cM
AA seq 837 aa
MVGLGACTLTGVTLIFLLLPRSLESCGHIEISPPVVRLGDPVLASCTISPNCSKLDQQAK
ILWRLQDEPIQPGDRQHHLPDGTQESLITLPHLNYTQAFLFCLVPWEDSVQLLDQAELHA
GYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVA
KKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGP
DVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQ
APVYTLQMRCIRSSLPGFWSPWSPGLQLRPTMKAPTIRLDTWCQKKQLDPGTVSVQLFWK
PTPLQEDSGQIQGYLLSWSSPDHQGQDIHLCNTTQLSCIFLLPSEAQNVTLVAYNKAGTS
SPTTVVFLENEGPAVTGLHAMAQDLNTIWVDWEAPSLLPQGYLIEWEMSSPSYNNSYKSW
MIEPNGNITGILLKDNINPFQLYRITVAPLYPGIVGPPVNVYTFAGERAPPHAPALHLKH
VGTTWAQLEWVPEAPRLGMIPLTHYTIFWADAGDHSFSVTLNISLHDFVLKHLEPASLYH
VYLMATSRAGSTNSTGLTLRTLDPSDLNIFLGILCLVLLSTTCVVTWLCCKRRGKTSFWS
DVPDPAHSSLSSWLPTIMTEETFQLPSFWDSSVPSITKITELEEDKKPTHWDSESSGNGS
LPALVQAYVLQGDPREISNQSQPPSRTGDQVLYGQVLESPTSPGVMQYIRSDSTQPLLGG
PTPSPKSYENIWFHSRPQETFVPQPPNQEDDCVFGPPFDFPLFQGLQVHGVEEQGGF
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggtagggctgggagcctgcaccctgactggagttaccctgatcttcttgctactcccc
agaagtctggagagctgtggacacatcgagatttcaccccctgttgtccgcctgggggac
cctgtcctggcctcttgcaccatcagcccaaactgcagcaaactggaccaacaggcaaag
atcttatggagactgcaagatgagcccatccaacctggggacagacagcatcatctgcct
gatgggacccaagagtccctcatcactctgcctcacttgaactacacccaggccttcctc
ttctgcttagtgccatgggaagacagcgtccaactcctggatcaagctgagcttcacgca
ggctatccccctgccagcccctcaaacctatcctgcctcatgcacctcaccaccaacagc
ctggtctgccagtgggagccaggtcctgagacccacctgcccaccagcttcatcctaaag
agcttcaggagccgcgccgactgtcagtaccaaggggacaccatcccggattgtgtggca
aagaagaggcagaacaactgctccatcccccgaaaaaacttgctcctgtaccagtatatg
gccatctgggtgcaagcagagaatatgctagggtccagcgagtccccaaagctgtgcctc
gaccccatggatgttgtgaaattggagcctcccatgctgcaggccctggacattggccct
gatgtagtctctcaccagcctggctgcctgtggctgagctggaagccatggaagcccagt
gagtacatggaacaggagtgtgaacttcgctaccagccacagctcaaaggagccaactgg
actctggtgttccacctgccttccagcaaggaccagtttgagctctgcgggctccatcag
gccccagtctacaccctacagatgcgatgcattcgctcatctctgcctggattctggagc
ccctggagccccggcctgcagctgaggcctaccatgaaggcccccaccatcagactggac
acgtggtgtcagaagaagcaactagatccagggacagtgagtgtgcagctgttctggaag
ccaacgcccctgcaggaagacagtggacagatccagggctacctgctgtcctggagttcc
ccagatcatcaagggcaggacatacacctttgcaacaccacgcagctcagctgtatcttc
ctcctgccctcagaggcccagaacgtgacccttgtggcctacaacaaagcagggacctct
tcacctactacagtggttttcctggagaacgaaggtccagctgtgaccggactccatgcc
atggcccaagaccttaacaccatctgggtagactgggaagcccccagccttctgcctcag
ggctatctcattgagtgggaaatgagttctcccagctacaataacagctataagtcctgg
atgatagaacctaacgggaacatcactggaattctgttaaaggacaacataaatcccttt
cagctctacagaattacagtggctcccctgtacccaggcatcgtgggacctcctgtaaat
gtctacaccttcgctggagagagagctcctcctcatgctccagcgctgcatctaaagcat
gttggcacaacctgggcacagctggagtgggtacctgaggcccctaggctggggatgata
cccctcacccactacaccatcttctgggccgatgctggggaccactccttctccgtcacc
ctgaacatctccctccatgactttgtcctgaagcacctggagcccgccagtttgtatcat
gtctacctcatggccaccagtcgggcagggtccaccaacagtacaggccttaccctgagg
accctagatccatctgacttaaacattttcctgggcatactttgcttagtactcttgtcc
actacctgtgtagtgacctggctctgctgcaaacgcagaggaaagacttccttctggtca
gatgtgccagacccagcccacagtagcctgagctcctggttgcccaccatcatgacagag
gaaaccttccagttacccagcttctgggactccagcgtgccatcaatcaccaagatcact
gaactggaggaagacaagaaaccgacccactgggattccgaaagctctgggaatggtagc
cttccagccctggttcaggcctatgtgctccaaggagatccaagagaaatttccaaccag
tcccagcctccctctcgcactggtgaccaggtcctctatggtcaggtgcttgagagcccc
accagcccaggagtaatgcagtacattcgctctgactccactcagcccctcttggggggc
cccacccctagccctaaatcttatgaaaacatctggttccattcaagaccccaggagacc
tttgtgccccaacctccaaaccaggaagatgactgtgtctttgggcctccatttgatttt
cccctctttcaggggctccaggtccatggagttgaagaacaagggggtttctag

KEGG   Mus musculus (mouse): 13857
Entry
13857             CDS       T01002                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    13857 (Epor)
   04151 PI3K-Akt signaling pathway
    13857 (Epor)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13857 (Epor)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    13857 (Epor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13857 (Epor)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    13857 (Epor)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   13857 (Epor)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 13857
NCBI-ProteinID: NP_034279
MGI: 95408
Ensembl: ENSMUSG00000006235
Vega: OTTMUSG00000062323
UniProt: P14753 Q3UTV9
Structure
PDB: 
2MXB

Position
9 A3; 9 7.93 cM
AA seq 507 aa
MDKLRVPLWPRVGPLCLLLAGAAWAPSPSLPDPKFESKAALLASRGSEELLCFTQRLEDL
VCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLE
LQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYE
VDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPAS
LLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPGIPSPESEFEGLFTTHK
GNFQLWLLQRDGCLWWSPGSSFPEDPPAHLEVLSEPRWAVTQAGDPGADDEGPLLEPVGS
EHAQDTYLVLDKWLLPRTPCSENLSGPGGSVDPVTMDEASETSSCPSDLASKPRPEGTSP
SSFEYTILDPSSQLLCPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQGVHGDSS
DGPYSHPYENSLVPDSEPLHPGYVACS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggacaaactcagggtgcccctctggcctcgggtaggccccctctgtctcctacttgct
ggggcagcctgggcaccttcacccagcctcccggaccccaagtttgagagcaaagcggcc
ctgctggcatcccggggctccgaagaacttctgtgcttcacccaacgcttggaagacttg
gtgtgtttctgggaggaagcggcgagctccgggatggacttcaactacagcttctcatac
cagctcgagggtgagtcacgaaagtcatgtagcctgcaccaggctcccaccgtccgcggc
tccgtgcgtttctggtgttcactgccaacagcggacacatcgagttttgtgccgctggag
ctgcaggtgacggaggcgtccggttctcctcgctatcaccgcatcatccatatcaatgaa
gtagtgctcctggacgcccccgcggggctgctggcgcgccgggcagaagagggcagccac
gtggtgctgcgctggctgccacctcctggagcacctatgaccacccacatccgatatgaa
gtggacgtgtcggcaggcaaccgggcaggagggacacaaagggtggaggtcctggaaggc
cgcactgagtgtgttctgagcaacctgcggggcgggacgcgctacaccttcgctgttcga
gcgcgcatggccgagccgagcttcagcggattctggagtgcctggtctgagcccgcgtca
ctactgaccgctagcgacctggaccctctcatcttgacgctgtctctcattctggtcctc
atctcgctgttgctgacggttctggccctgctgtcccaccgccggactctgcagcagaag
atctggcctggcatcccaagcccagagagcgagtttgagggtctcttcaccacccacaag
ggtaacttccagctgtggctgctgcagcgtgatggttgtctgtggtggagcccgggcagc
tccttccctgaggatccacctgcccacctagaggtcctctcagagccacgctgggcagtg
actcaggctggggacccaggggcagatgatgaggggcccttactggagccggtgggcagt
gagcatgcccaggacacctacttggtattggataagtggttgctgccccggaccccatgc
agtgagaacctctcagggcctgggggcagtgtggaccctgtgactatggatgaagcttca
gaaacatcttcctgcccgtctgacttggcctcaaagcccaggccagagggcacctcacct
tccagctttgagtacaccatcctggaccccagctctcagctcctgtgccctcgggcactg
cctcccgagctacctcccactccacctcacttgaagtacctataccttgtggtgtccgat
tctggcatctcaacagattacagttcggggggctctcagggagtccacggggactcatct
gatggcccctactcccacccctatgagaacagccttgtcccagactcagagcctctgcat
cccggctatgtggcctgctcctag

KEGG   Mus musculus (mouse): 14600
Entry
14600             CDS       T01002                                 

Gene name
Ghr, GHB, GHBP, GHR/, GHR/BP
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    14600 (Ghr)
   04151 PI3K-Akt signaling pathway
    14600 (Ghr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14600 (Ghr)
   04060 Cytokine-cytokine receptor interaction
    14600 (Ghr)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    14600 (Ghr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    14600 (Ghr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   14600 (Ghr)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 Cna_B
Other DBs
NCBI-GeneID: 14600
NCBI-ProteinID: NP_001273299
MGI: 95708
Ensembl: ENSMUSG00000055737
Vega: OTTMUSG00000030599
UniProt: P16882 Q3UP14
Position
15 A1; 15 1.84 cM
AA seq 650 aa
MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPE
LETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSC
YFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQ
VSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRS
RQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQ
RIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDID
EADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTL
KFAQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQ
LASTPMSNPTSLANIDFYAQVSDITPAGGVVLSPGQKIKAGIAQGNTQREVATPCQENYS
MNSAYFCESDAKKCIAVAPRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAE
MSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggatctttgtcaggtcttcttaaccttggcactggcagtcaccagcagcacattttct
ggaagtgaggctacaccagctactcttggcaaagcttccccagttctgcaaagaatcaat
ccaagcctggggacaagttcttctggaaagcctcgattcaccaagtgtcgttcccctgaa
ctggagacattttcatgctactggacagaaggagataatcctgatttaaagaccccagga
tctattcagctgtactatgctaaaagggaaagccaacgacaagctgcaagaattgctcat
gaatggacccaggaatggaaagaatgccctgattatgtctctgctggaaaaaacagctgt
tacttcaactcatcatatacctccatttggataccctactgcatcaagctaactacaaat
ggtgatttgctggaccaaaaatgtttcactgttgacgaaatagtgcaacctgatccaccc
attggcctcaactggactttactaaacattagtttgaccgggattcgtggagacatccaa
gtgagttggcaaccaccacccaatgcagatgttctgaagggatggataattctggagtat
gaaattcagtacaaagaagtaaatgaatcaaaatggaaagtgatgggccctatatggtta
acatactgtccagtgtactcattgagaatggataaagaacatgaagtgcgggtgagatcc
agacaacggagctttgaaaagtacagcgagttcagcgaagtcctccgtgtaatatttcct
cagacgaacatattggaagcatgtgaagaagatatccagtttccatggttcttaattatt
atctttggaatatttggagtagcagtgatgctatttgtagttatattttcaaagcagcaa
aggattaagatgctgattttacccccagtcccagttccaaagattaaagggattgatcca
gatcttctcaaggaagggaagttggaggaggtgaacaccatcttaggcattcatgataac
tacaaacccgacttctacaatgatgattcctgggtcgagttcattgagctagatattgat
gaagcagatgtggatgagaagactgaagggtctgacacagacagacttctaagcaatgat
catgagaaatcagctggtatccttggagcaaaggatgatgattctgggcgtaccagctgt
tacgaccctgacattttggatactgatttccataccagtgacatgtgtgatggtaccttg
aagtttgctcagtcacagaagttaaatatggaagctgatctcttgtgccttgatcagaag
aatctgaagaacttgccttatgatgcttcccttggctctctgcatccctccattacccag
acagtagaagaaaacaagccacagccacttttgagcagcgaaactgaggcaacccaccaa
ctcgcctctacaccgatgagtaatcccacatcactggcaaacattgacttttatgcccaa
gtaagcgacattacaccagcaggtggtgtagtcctttccccaggccaaaagattaaggca
gggatagcccaaggcaatacccagcgggaggtggccacgccctgccaagaaaattacagc
atgaacagtgcctacttttgtgagtcagatgccaaaaaatgcatcgctgtggcccctcgc
atggaagccacgtcttgtataaaaccaagctttaaccaagaggacatttacatcaccaca
gaaagccttaccactactgcccagatgtctgagacagcagatattgctccagatgctgag
atgtctgtcccagactacaccacggttcacaccgtgcagtctccaaggggccttatactc
aacgcaactgctttgcctttgcctgacaaaaagaattttccctcctcgtgtggttatgtg
agcacagaccaactgaacaaaatcatgcagtag

KEGG   Mus musculus (mouse): 15975
Entry
15975             CDS       T01002                                 

Gene name
Ifnar1, I, If, Ifar, Ifnar, Ifrc, Infar
Definition
(RefSeq) interferon (alpha and beta) receptor 1
  KO
K05130  interferon receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15975 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    15975 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15975 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15975 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15975 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    15975 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    15975 (Ifnar1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15975 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15975 (Ifnar1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    15975 (Ifnar1)
   05160 Hepatitis C
    15975 (Ifnar1)
   05171 Coronavirus disease - COVID-19
    15975 (Ifnar1)
   05164 Influenza A
    15975 (Ifnar1)
   05162 Measles
    15975 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    15975 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15975 (Ifnar1)
   05169 Epstein-Barr virus infection
    15975 (Ifnar1)
   05165 Human papillomavirus infection
    15975 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15975 (Ifnar1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15975 (Ifnar1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 15975
NCBI-ProteinID: NP_034638
MGI: 107658
Ensembl: ENSMUSG00000022967
Vega: OTTMUSG00000027185
UniProt: P33896
Structure
PDB: 
3WCY

Position
16 C3.3; 16 52.98 cM
AA seq 590 aa
MLAVVGAAALVLVAGAPWVLPSAAGGENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTF
SAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPF
IPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTI
NSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQ
GKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPIPTCANVQTTHCVFSQDTVY
TGTFFLHVQASEGNHTSFWSEEKFIDSQKHILPPPPVITVTAMSDTLLVYVNCQDSTCDG
LNYEIIFWENTSNTKISMEKDGPEFTLKNLQPLTVYCVQARVLFRALLNKTSNFSEKLCE
KTRPGSFSTIWIITGLGVVFFSVMVLYALRSVWKYLCHVCFPPLKPPRSIDEFFSEPPSK
NLVLLTAEEHTERCFIIENTDTVAVEVKHAPEEDLRKYSSQTSQDSGNYSNEEEESVGTE
SGQAVLSKAPCGGPCSVPSPPGTLEDGTCFLGNEKYLQSPALRTEPALLC
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgctcgctgtcgtgggcgcggcggccctggtgctggtggccggggcgccttgggtgcta
ccctcagctgcaggtggagaaaatctgaaacctcctgagaatatagacgtctacattata
gatgacaactacaccctaaagtggagcagccacggagagtcaatgggcagtgtgaccttt
tcagcagaatatcgaacaaaagacgaggcgaagtggttaaaagtgcctgaatgtcaacat
actacaacgaccaagtgtgaattctctttactggacacaaatgtgtatatcaaaacacag
tttcgtgtcagagcagaggaagggaacagcacatcttcgtggaatgaggttgatccgttt
attccattctacacagctcacatgagccccccagaagtacgtttagaagctgaagataaa
gccatactagtccacatctctcctcccggacaagacgggaacatgtgggcactggagaaa
ccttccttcagttacaccatacgaatctggcagaagtcttccagtgacaaaaaaactatt
aactctacgtattatgtagaaaagataccagaactcttgccagagactacttactgttta
gaagttaaagcaatacatccgtcacttaagaaacacagcaattacagcactgtgcagtgt
ataagcaccacagtggcaaataaaatgcctgtgccaggaaatctccaagtggatgcccaa
ggcaagagctatgtcctgaaatgggactacattgcgtctgcagacgtgctcttcagggca
cagtggcttcctggctattcaaaaagcagttctggaagccgttcagataaatggaaacca
ataccaacctgtgcaaatgtccagactacgcactgtgtcttttctcaagatactgtctac
acaggaacgttctttctccatgtacaagcctcagagggaaatcacacatccttttggtct
gaagagaagtttattgattctcaaaaacacattctccctcctcctccggtcattactgtc
accgccatgagtgacaccttgcttgtttatgtcaactgtcaggacagcacatgtgatgga
ctcaattacgaaatcatcttttgggaaaacacttccaatactaagataagcatggagaag
gatggcccagagttcaccctcaagaacctgcagccgctgactgtgtactgtgtccaggcc
agagtgctcttcagggccctgctgaataagaccagcaacttcagtgaaaagctgtgtgag
aaaacacgtccaggaagtttttccacgatctggattataactggattaggtgttgtgttc
ttctctgtcatggtcctttatgctttgaggagcgtctggaaatacctgtgtcatgtgtgc
ttcccaccactcaagcctccccgcagtattgatgagtttttctctgagccgccttcaaaa
aaccttgtacttctgacggctgaggagcacacggaaagatgcttcatcattgagaataca
gacacggtcgctgtagaagtaaagcacgcgcctgaggaggacctcaggaagtacagctca
cagaccagccaggactcgggcaactattccaacgaagaggaggagagtgtgggcaccgag
agcggccaagctgtgctctccaaagctccctgcggggggccatgcagcgtgcctagccct
cctgggaccttggaagacgggacctgcttcctgggaaatgaaaaatatcttcagagccca
gccctgaggacagagccagctcttctctgctga

KEGG   Mus musculus (mouse): 15976
Entry
15976             CDS       T01002                                 

Gene name
Ifnar2, AI747302, Ifn, Ifnar-2
Definition
(RefSeq) interferon (alpha and beta) receptor 2
  KO
K05131  interferon receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15976 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    15976 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15976 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15976 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15976 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    15976 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    15976 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15976 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15976 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    15976 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    15976 (Ifnar2)
   05164 Influenza A
    15976 (Ifnar2)
   05162 Measles
    15976 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    15976 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15976 (Ifnar2)
   05169 Epstein-Barr virus infection
    15976 (Ifnar2)
   05165 Human papillomavirus infection
    15976 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15976 (Ifnar2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15976 (Ifnar2)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac IL6Ra-bind
Other DBs
NCBI-GeneID: 15976
NCBI-ProteinID: NP_034639
MGI: 1098243
Ensembl: ENSMUSG00000022971
Vega: OTTMUSG00000040135
UniProt: O35664
Position
16 C3.3; 16 52.82 cM
AA seq 513 aa
MRSRCTVSAVGLLSLCLVVSASLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKS
GPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTV
CRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDS
VRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSE
SAIVGITTSCLVVMVFVSTIVMLKRIGYICLKDNLPNVLNFRHFLTWIIPERSPSEAIDR
LEIIPTNKKKRLWNYDYEDGSDSDEEVPTASVTGYTMHGLTGKPLQQTSDTSASPEDPLH
EEDSGAEESDEAGAGAGAEPELPTEAGAGPSEDPTGPYERRKSVLEDSFPREDNSSMDEP
GDNIIFNVNLNSVFLRVLHDEDASETLSLEEDTILLDEGPQRTESDLRIAGGDRTQPPLP
SLPSQDLWTEDGSSEKSDTSDSDADVGDGYIMR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgcgttcacggtgcaccgtctctgccgtcggtctcctcagcttgtgtcttgtggtgtct
gcgagcctagagactatcacaccgtctgcttttgatgggtatccagatgaaccttgcact
ataaacataacaatacgaaattcccggctaattttatcctgggaattagagaacaagtct
ggcccacccgctaactacaccctctggtacacagtcatgagcaaagacgaaaatctgacg
aaggttaagaactgttcagataccacgaagtcatcatgtgacgtgacagataagtggttg
gagggcatggagagctacgtcgtcgccatcgtcatagtgcacagaggggacttgaccgtg
tgccgctgctcagactacatcgtgcctgcaaacgctcctcttgagccgccagaatttgag
atcgttggctttacagaccacataaacgtgacgatggaatttccacctgtcacttccaaa
ataatccaggaaaagatgaagactacaccctttgtcatcaaagaacagataggggacagc
gttaggaagaagcacgagcccaaagtgaataatgtcactgggaacttcacatttgtcctt
agagacttacttccaaagacaaactactgtgtatctctttattttgatgatgaccccgca
ataaaatctcccttaaaatgcatcgtccttcagcctggccaggaatcaggattatcagaa
tctgctatagtaggaataactacttcgtgtttggtagtgatggttttcgtgagcactatc
gtaatgctgaaacggattggttatatatgcctaaaagacaatttgcccaatgtcttgaac
ttccgccactttttaacctggataatccctgaacggtcaccttcagaagccatcgatcgg
ctggaaatcatccccacaaacaagaagaagagactgtggaattacgattatgaggatggc
agtgacagtgacgaagaggtccccacagcaagtgtcactggctacaccatgcatggactg
acgggcaagcctctgcaacaaacctctgacacctcagccagccccgaggatcccctgcat
gaagaagattcaggcgctgaggaatctgatgaagctggagcaggggctggagctgagcca
gaactccccacagaggcgggggcggggccttcagaagaccccactggcccctatgagaga
agaaagagtgtgctcgaggactcattccccagggaggacaacagctccatggatgagcct
ggggacaacattatcttcaacgtgaacttaaactctgtgtttctgagggttctccatgat
gaagatgcctcagagacattatctctcgaagaagacaccatcctcctagacgaaggtccc
cagaggacagagtcagaccttcggatagctggtggggacaggacacagccgcccctcccc
agccttccttcccaggatctatggactgaagatgggtcatctgagaaatcagacacctca
gattccgatgctgatgtgggggacggctacatcatgagatga

KEGG   Mus musculus (mouse): 16184
Entry
16184             CDS       T01002                                 

Gene name
Il2ra, CD25, I, Il2r, Ly-4, Ly-43
Definition
(RefSeq) interleukin 2 receptor, alpha chain
  KO
K05068  interleukin 2 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16184 (Il2ra)
   04151 PI3K-Akt signaling pathway
    16184 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16184 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16184 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16184 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16184 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    16184 (Il2ra)
   04659 Th17 cell differentiation
    16184 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16184 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16184 (Il2ra)
   05162 Measles
    16184 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16184 (Il2ra)
   04090 CD molecules [BR:mmu04090]
    16184 (Il2ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16184 (Il2ra)
CD molecules [BR:mmu04090]
 Proteins
  16184 (Il2ra)
SSDB
Motif
Pfam: Sushi DUF4834
Other DBs
NCBI-GeneID: 16184
NCBI-ProteinID: NP_032393
MGI: 96549
Ensembl: ENSMUSG00000026770
Vega: OTTMUSG00000011179
UniProt: P01590 Q544I2
Position
2 A1; 2 8.91 cM
AA seq 268 aa
MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKE
LVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGH
CREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTC
VDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVA
SCLFLLISILLLSGLTWQHRWRKSRRTI
NT seq 807 nt   +upstreamnt  +downstreamnt
atggagccacgcttgctgatgttggggtttctctcattaaccatagtacccagttgtcgg
gcagaactgtgtctgtatgacccacccgaggtccccaatgccacattcaaagccctctcc
tacaagaacggcaccatcctaaactgtgaatgcaagagaggtttccgaagactaaaggaa
ttggtctatatgcgttgcttaggaaactcctggagcagcaactgccagtgcaccagcaac
tcccatgacaaatcgagaaagcaagttacagctcaacttgaacaccagaaagagcaacaa
accacaacagacatgcagaagccaacacagtctatgcaccaagagaaccttacaggtcac
tgcagggagccacctccttggaaacatgaagattccaagagaatctatcatttcgtggaa
ggacagagtgttcactacgagtgtattccgggatacaaggctctacagagaggtcctgct
attagcatctgcaagatgaagtgtgggaaaacggggtggactcagccccagctcacatgt
gtagatgaaagagaacaccaccgatttctggctagtgaggaatctcaaggaagcagaaat
tcttctcccgagagtgagacttcctgccccataaccaccacagacttcccacaacccaca
gaaacaactgcaatgacggagacatttgtgctcacaatggagtataaggtagcagtggcc
agctgcctcttcctgctcatcagcatcctcctcctgagcgggctcacctggcaacacaga
tggaggaagagcagaagaaccatctag

KEGG   Mus musculus (mouse): 16185
Entry
16185             CDS       T01002                                 

Gene name
Il2rb, CD122, IL-15R, IL-15Rbeta, IL15R, IL15Rbeta, Il-2/15Rbeta, Il-2R, Il-2Rbeta, p70
Definition
(RefSeq) interleukin 2 receptor, beta chain
  KO
K05069  interleukin 2 receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16185 (Il2rb)
   04151 PI3K-Akt signaling pathway
    16185 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16185 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16185 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16185 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16185 (Il2rb)
   04659 Th17 cell differentiation
    16185 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16185 (Il2rb)
   05202 Transcriptional misregulation in cancer
    16185 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16185 (Il2rb)
   05162 Measles
    16185 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16185 (Il2rb)
   04090 CD molecules [BR:mmu04090]
    16185 (Il2rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16185 (Il2rb)
CD molecules [BR:mmu04090]
 Proteins
  16185 (Il2rb)
SSDB
Motif
Pfam: IL2RB_N1 fn3
Other DBs
NCBI-GeneID: 16185
NCBI-ProteinID: NP_032394
MGI: 96550
Ensembl: ENSMUSG00000068227
UniProt: P16297
Structure
PDB: 
6DG5

Position
15 E1; 15 37.52 cM
AA seq 539 aa
MATIALPWSLSLYVFLLLLATPWASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCH
VHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRV
KTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWE
DASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
ILPMSWLRYLLLVLGCFSGFFSCVYILVKCRYLGPWLKTVLKCHIPDPSEFFSQLSSQHG
GDLQKWLSSPVPLSFFSPSGPAPEISPLEVLDGDSKAVQLLLLQKDSAPLPSPSGHSQAS
CFTNQGYFFFHLPNALEIESCQVYFTYDPCVEEEVEEDGSRLPEGSPHPPLLPLAGEQDD
YCAFPPRDDLLLFSPSLSTPNTAYGGSRAPEERSPLSLHEGLPSLASRDLMGLQRPLERM
PEGDGEGLSANSSGEQASVPEGNLHGQDQDRGQGPILTLNTDAYLSLQELQAQDSVHLI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggctaccatagctcttccctggagcctgtccctctacgtcttcctcctgctcctggct
acaccttgggcatctgcagcagtgaaaaactgttcccatcttgaatgcttctacaactca
agagccaatgtctcttgcatgtggagccatgaagaggctctgaatgtcacaacctgccac
gtccatgccaagtcgaacctgcgacactggaacaaaacctgtgagctaactcttgtgagg
caggcatcctgggcctgcaacctgatcctcgggtcgttcccagagtcccagtcactgacc
tccgtggacctccttgacataaatgtggtgtgctgggaagagaagggttggcgtagggta
aagacctgcgacttccatccctttgacaaccttcgcctggtggcccctcattccctccaa
gttctgcacattgatacccagagatgtaacataagctggaaggtctcccaggtctctcac
tacattgaaccatacttggaatttgaggcccgtagacgtcttctgggccacagctgggag
gatgcatccgtattaagcctcaagcagagacagcagtggctcttcttggagatgctgatc
cctagtacctcatatgaggtccaggtgagggtcaaagctcaacgaaacaataccgggacc
tggagtccctggagccagcccctgacctttcggacaaggccagcagatcccatgaaggag
atcctccccatgtcatggctcagataccttctgctggtccttggttgtttttctggcttc
ttctcctgcgtctacattttggtcaagtgccggtaccttgggccatggctgaagacagtt
ctcaagtgccacatcccagatccttctgagttcttctcccagctgagctcccagcatggg
ggagaccttcagaaatggctctcctcgcctgtccccttgtccttcttcagccccagtggc
cctgcccctgagatctctccgctggaagtgctcgacggagattccaaggccgtgcagctg
ctcctgttacagaaggactctgcccctttaccctcgcccagcggccactcacaggccagc
tgcttcaccaaccagggctacttcttcttccatctgcccaatgccttggagatcgaatcc
tgccaggtgtacttcacctatgacccctgtgtggaagaggaggtggaggaggatgggtca
aggctgcccgagggatctccccacccacctctgctgcctctggctggagaacaggatgac
tactgtgccttcccgcccagggatgacctgctgctcttctccccgagcctcagcaccccc
aacactgcctatgggggcagcagagcccctgaagaaagatctccactctccctgcatgag
ggacttccctccctagcatcccgtgacctgatgggcttacagcgccctctggagcggatg
ccggaaggtgatggagaggggctgtctgccaatagctctggggagcaggccagtgtccca
gaaggcaaccttcatgggcaagatcaggacagaggccagggccccatcctgaccctgaac
accgatgcctatctgtctcttcaagaactacaggcccaagattcagtccacctaatatag

KEGG   Mus musculus (mouse): 16186
Entry
16186             CDS       T01002                                 

Gene name
Il2rg, CD132, [g]c, gamm, gamma(, gamma(c), gc, p64
Definition
(RefSeq) interleukin 2 receptor, gamma chain
  KO
K05070  interleukin 2 receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16186 (Il2rg)
   04151 PI3K-Akt signaling pathway
    16186 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16186 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16186 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16186 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16186 (Il2rg)
   04659 Th17 cell differentiation
    16186 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16186 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16186 (Il2rg)
   05162 Measles
    16186 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16186 (Il2rg)
   05340 Primary immunodeficiency
    16186 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16186 (Il2rg)
   04090 CD molecules [BR:mmu04090]
    16186 (Il2rg)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16186 (Il2rg)
CD molecules [BR:mmu04090]
 Proteins
  16186 (Il2rg)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N Interfer-bind IL2RB_N1 Tissue_fac
Other DBs
NCBI-GeneID: 16186
NCBI-ProteinID: NP_038591
MGI: 96551
Ensembl: ENSMUSG00000031304
Vega: OTTMUSG00000018211
UniProt: P34902 Q3UPA9
Structure
PDB: 
6DG5

Position
X D; X 43.9 cM
AA seq 369 aa
MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEV
QCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIK
ERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSK
WSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLV
TEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPP
PCYSLKPEA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaaactattattgtcacctagatccttcttagtccttcagctgctcctgctgagg
gcagggtggagctccaaggtcctcatgtccagtgcgaatgaagacatcaaagctgatttg
atcctgacttctacagcccctgaacacctcagtgctcctactctgccccttccagaggtt
cagtgctttgtgttcaacatagagtacatgaattgcacttggaatagcagttctgagcct
caggcaaccaacctcacgctgcactataggtacaaggtatctgataataatacattccag
gagtgcagtcactatttgttctccaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagctccaggacccccagaaaccccagagg
cgagctgtacagaagctaaacctacagaatcttgtgatcccacgggctccagaaaatcta
acactcagcaatctgagtgaatcccagctagagctgagatggaaaagcagacatattaaa
gaacgctgtttacaatacttggtgcagtaccggagcaacagagatcgaagctggacggaa
ctaatagtgaatcatgaacctagattctccctgcctagtgtggatgagctgaaacggtac
acatttcgggttcggagccgctataacccaatctgtggaagttctcaacagtggagtaaa
tggagccagcctgtccactgggggagtcatactgtagaggagaatccttccttgtttgca
ctggaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtg
tactgttggttggaacgaatgcctccaattccccccatcaagaatctagaggatctggtt
actgaataccaagggaacttttcggcctggagtggtgtgtctaaagggctgactgagagt
ctgcagccagactacagtgaacggttctgccacgtcagcgagattccccccaaaggaggg
gccctaggagaggggcctggaggttctccttgcagcctgcatagcccttactggcctccc
ccatgttattctctgaagccggaagcctga

KEGG   Mus musculus (mouse): 16188
Entry
16188             CDS       T01002                                 

Gene name
Il3ra, CD123, CDw123, SUT-, SUT-1
Definition
(RefSeq) interleukin 3 receptor, alpha chain
  KO
K04737  interleukin 3 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16188 (Il3ra)
   04151 PI3K-Akt signaling pathway
    16188 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16188 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    16188 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16188 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16188 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16188 (Il3ra)
   04090 CD molecules [BR:mmu04090]
    16188 (Il3ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16188 (Il3ra)
CD molecules [BR:mmu04090]
 Proteins
  16188 (Il3ra)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 16188
NCBI-ProteinID: NP_032395
MGI: 96553
Ensembl: ENSMUSG00000068758
UniProt: P26952
Position
14 A1; 14 7.08 cM
AA seq 396 aa
MAANLWLILGLLASHSSDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGA
FCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAA
QDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAP
HGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPT
LTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFR
VKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLL
YRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggccgccaacctgtggctcatcctggggctcctggcatcccactcttcagatctggct
gcggtccgtgaggctccacccactgctgtgaccacgcccatccagaacctgcatatcgac
cccgcccactacacactgagctgggaccccgcccccggcgctgacatcacgacaggggct
ttttgcaggaagggcagggacatctttgtctgggctgaccccgggcttgcccgctgctca
ttccagtcgctctccctctgccatgtgaccaacttcaccgtcttcctggggaaggacagg
gctgtggcaggatccatccagttccccccagatgatgatggcgaccacgaggccgcagcc
caggacctgcgctgctgggtgcatgaggggcagctgagctgccaatgggagcggggtccg
aaagcaacgggtgacgtgcactaccggatgttctggcgtgatgtgcggctcggtcctgcc
cacaaccgcgagtgtccacactaccacagccttgatgtcaacaccgctggccccgcccct
catggtggccatgaaggctgcacccttgacctcgacactgtccttggctccacccccaac
agccctgaccttgtcccccaggtcaccatcaccgtcaacggcagtggccgcgctggcccc
gtgccctgcatggacaacactgtggacctgcagcgcgcagaggtcctggccccgcccacg
ttgacagtggagtgcaacggctctgaggcccatgcccgatgggtcgcgcggaacagattc
caccatggcctccttgggtacaccctgcaggtcaaccagagctcccgctcagagccacag
gaatacaatgtctccatcccccacttctgggtccccaacgctggtgccatctccttccgg
gtcaagtcgaggtcagaggtttaccctcggaagctcagcagctggagcgaagcctggggc
ctcgtctgccccccagaggtgatgcctgtgaagacagccttggtgacttcagtggctacg
gtgctgggggcagggctcgtggcagctgggctcctgctgtggtggaggaagtcgctgctc
taccgcctgtgcccacccattccacgcctgcgcctgcccttggcaggggagatggtcgtg
tgggaaccagctcttgaagactgcgaggtgacgcctgtgacagacgcctga

KEGG   Mus musculus (mouse): 16190
Entry
16190             CDS       T01002                                 

Gene name
Il4ra, CD124, I, Il4r
Definition
(RefSeq) interleukin 4 receptor, alpha
  KO
K05071  interleukin 4 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16190 (Il4ra)
   04151 PI3K-Akt signaling pathway
    16190 (Il4ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16190 (Il4ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16190 (Il4ra)
   04658 Th1 and Th2 cell differentiation
    16190 (Il4ra)
   04659 Th17 cell differentiation
    16190 (Il4ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16190 (Il4ra)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16190 (Il4ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16190 (Il4ra)
   04090 CD molecules [BR:mmu04090]
    16190 (Il4ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16190 (Il4ra)
CD molecules [BR:mmu04090]
 Proteins
  16190 (Il4ra)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 16190
NCBI-ProteinID: NP_001008700
MGI: 105367
Ensembl: ENSMUSG00000030748
Vega: OTTMUSG00000058201
UniProt: P16382 Q3U905
Position
7 F3; 7 68.94 cM
AA seq 810 aa
MGRLCTKFLTSVGCLILLLVTGSGSIKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCL
HYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSG
NVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTY
KEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQRLPLGVTI
SCLCIPLFCLFCYFSITKIKKIWWDQIPTPARSPLVAIIIQDAQVPLWDKQTRSQESTKY
PHWKTCLDKLLPCLLKHRVKKKTDFPKAAPTKSLQSPGKAGWCPMEVSRTVLWPENVSVS
VVRCMELFEAPVQNVEEEEDEIVKEDLSMSPENSGGCGFQESQADIMARLTENLFSDLLE
AENGGLGQSALAESCSPLPSGSGQASVSWACLPMGPSEEATCQVTEQPSHPGPLSGSPAQ
SAPTLACTQVPLVLADNPAYRSFSDCCSPAPNPGELAPEQQQADHLEEEEPPSPADPHSS
GPPMQPVESWEQILHMSVLQHGAAAGSTPAPAGGYQEFVQAVKQGAAQDPGVPGVRPSGD
PGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELSPS
PLNSDPPKSPPECLGLELGLKGGDWVKAPPPADQVPKPFGDDLGFGIVYSSLTCHLCGHL
KQHHSQEEGGQSPIVASPGCGCCYDDRSPSLGSLSGALESCPEGIPPEANLMSAPKTPSN
LSGEGKGPGHSPVPSQTTEVPVGALGIAVS
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggggcggctttgcaccaagttcctgacctctgtgggctgtctgattttgctgttggtg
actggatctgggagcatcaaggtcctgggtgagcccacctgcttctctgactacatccgc
acttccacgtgtgagtggttcctggatagcgctgtggactgcagttctcagctctgccta
cactacaggctgatgttcttcgagttctctgaaaacctcacatgcatcccgaggaacagt
gccagcactgtgtgtgtgtgccacatggaaatgaataggccggtccaatcagacagatac
cagatggaactgtgggctgagcacagacagctgtggcagggctccttcagccccagtggt
aatgtgaagcccctagctccagacaacctcacactccacaccaatgtgtccgacgaatgg
ctgctgacctggaataacctgtacccatcgaacaacttactgtacaaagacctcatctcc
atggtcaacatctccagagaggacaaccctgcagaattcatagtctataatgtgacctac
aaggaacccaggctgagcttcccgatcaacatcctgatgtcaggggtctactatacggcg
cgtgtgagggtcagatcccagatactcactggcacctggagtgagtggagtcctagcatc
acgtggtacaaccacttccagctgcccctgatacagcgccttccactgggggtcaccatc
tcctgcctctgcatcccgttgttttgcctgttctgttacttcagcattaccaagattaag
aagatatggtgggaccagattcccaccccagcacgcagtcccttggtggccatcatcatt
caggatgcacaggtgcccctctgggataagcagacccgaagccaggagtcaaccaagtac
ccgcactggaaaacttgtctagacaagctgctgccttgcttgctgaagcacagagtaaag
aagaagacagacttcccgaaggctgccccaaccaagtctctccagagtcctggaaaggca
ggctggtgtcccatggaggtcagcaggaccgtcctctggccagagaatgttagtgtcagt
gtggtgcgctgtatggagctgtttgaggccccagtacagaatgtggaggaggaagaagat
gagatagtcaaagaggacctgagcatgtcacctgagaacagcggaggctgcggcttccag
gagagccaggcagacatcatggctcggctcactgagaacctgttttccgacttgttggag
gctgagaatgggggccttggccagtcagccttggcagagtcatgctcccctctgccttca
ggaagtgggcaggcttctgtatcctgggcctgcctccccatggggcccagtgaggaggcc
acatgccaggtcacagagcagccttcacacccaggccctctttcaggcagcccagcccag
agtgcacctactctggcttgcacgcaggtcccacttgtccttgcagacaatcctgcctac
cggagttttagtgactgctgtagcccggccccaaatcctggagagctggctccagagcag
cagcaggctgatcatctggaagaagaggagcctccaagcccggctgacccccattcttca
gggccaccaatgcagccagtggagagctgggagcagatccttcacatgagtgtcctgcag
catggggcagctgctggctccaccccagcccctgccggtggctaccaggagtttgtgcag
gcagtgaagcagggtgccgcccaggatcctggggtgcctggtgtcaggccttctggagac
cccggttacaaggccttctcgagcctgctcagcagcaatggcatccgcggggacacagca
gcagcggggactgacgatgggcatggaggctacaagcccttccagaatcctgttcctaac
cagtcccctagctccgtgcccttatttactttcggactagacacggagctgtcacccagt
cctctgaactcagacccacccaaaagccccccagaatgccttggtctggagctggggctc
aaaggaggtgactgggtgaaggcccctcctcctgcagatcaggtgcccaagccctttggg
gatgacctgggctttggtattgtgtactcgtccctcacttgccacttgtgtggccacctg
aagcaacaccacagccaggaggaaggtggccagagccccatcgttgctagccctggctgt
ggctgctgctacgatgacagatcaccatccctggggagcctctcgggggccttggaaagc
tgtcctgagggaataccaccagaagccaacctcatgtcagcacccaagacaccctcaaac
ttgtcaggggagggcaagggccctggtcactctcctgttcccagccagacgaccgaggtg
cctgtgggcgccctgggcattgctgtttcttag

KEGG   Mus musculus (mouse): 16194
Entry
16194             CDS       T01002                                 

Gene name
Il6ra, CD126, I, IL, IL-6R, IL-6R-alpha, IL-6RA, Il6r
Definition
(RefSeq) interleukin 6 receptor, alpha
  KO
K05055  interleukin 6 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04659  Th17 cell differentiation
mmu04932  Non-alcoholic fatty liver disease
mmu05163  Human cytomegalovirus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16194 (Il6ra)
   04066 HIF-1 signaling pathway
    16194 (Il6ra)
   04151 PI3K-Akt signaling pathway
    16194 (Il6ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16194 (Il6ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16194 (Il6ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16194 (Il6ra)
   04659 Th17 cell differentiation
    16194 (Il6ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16194 (Il6ra)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    16194 (Il6ra)
   05163 Human cytomegalovirus infection
    16194 (Il6ra)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    16194 (Il6ra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16194 (Il6ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16194 (Il6ra)
   04090 CD molecules [BR:mmu04090]
    16194 (Il6ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16194 (Il6ra)
CD molecules [BR:mmu04090]
 Proteins
  16194 (Il6ra)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 fn3 I-set V-set Ig_6 Ig_5
Other DBs
NCBI-GeneID: 16194
NCBI-ProteinID: NP_034689
MGI: 105304
Ensembl: ENSMUSG00000027947
Vega: OTTMUSG00000052883
UniProt: P22272 Q3URV7
Position
3 F1; 3 39.19 cM
AA seq 460 aa
MLTVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHW
VYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRK
NPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEG
DKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPET
WDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQW
SEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSS
MSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPLKPTFLL
VPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgctgaccgtcggctgcacgctgttggtcgccctgctggccgcgcccgcggtcgcgctg
gtcctcgggagctgccgcgcgctggaggtggcaaatggcacagtgacaagcctgccaggg
gccaccgttaccctgatttgccccgggaaggaagcagcaggcaatgttaccattcactgg
gtgtactctggctcacaaaacagagaatggactaccacaggaaacacactggttctgagg
gacgtgcagctcagcgacactggggactatttatgctccctgaatgatcacctggtgggg
actgtgcccttgctggtggatgttcccccagaggagcccaagctctcctgcttccggaag
aacccccttgtcaacgccatctgtgagtggcgtccgagcagcaccccctctccaaccacg
aaggctgtgctgtttgcaaagaaaatcaacaccaccaacgggaagagtgacttccaggtg
ccctgtcagtattctcagcagctgaaaagcttctcctgccaggtggagatcctggagggt
gacaaagtataccacatagtgtcactgtgcgttgcaaacagtgtgggaagcaagtccagc
cacaacgaagcgtttcacagcttaaaaatggtgcagccggatccacctgccaaccttgtg
gtatcagccatacctggaaggccgcgctggctcaaagtcagctggcagcaccctgagacc
tgggacccgagttactacttgctgcagttccagcttcgataccgacctgtatggtcaaag
gagttcacggtgttgctgctcccggtggcccagtaccaatgcgtcatccatgatgccttg
cgaggagtgaagcacgtggtccaggtccgtgggaaggaggagcttgaccttggccagtgg
agcgaatggtccccagaggtcacgggcactccttggatagcagagcccaggaccaccccg
gcaggaatcctctggaaccccacacaggtctctgttgaagactctgccaaccacgaggat
cagtacgaaagttctacagaagcaacgagtgtcctcgccccagtgcaagaatcctcgtcc
atgtccctgcccacattcctggtagctggaggaagcttggcgtttgggttgcttctctgt
gtcttcatcatcctgagactcaagcagaaatggaagtcagaggctgagaaggaaagcaag
acgacctctcctccacccccaccgtattccttgggcccactgaagccgaccttccttctg
gttcctctcctcaccccacacagctctgggtctgacaataccgtaaaccacagctgcctg
ggtgtcagggacgcacagagcccttatgacaacagcaacagagactacttattccccaga
taa

KEGG   Mus musculus (mouse): 16197
Entry
16197             CDS       T01002                                 

Gene name
Il7r, CD127, IL-, IL-7Ralpha
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16197 (Il7r)
   04068 FoxO signaling pathway
    16197 (Il7r)
   04151 PI3K-Akt signaling pathway
    16197 (Il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16197 (Il7r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16197 (Il7r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16197 (Il7r)
  09163 Immune disease
   05340 Primary immunodeficiency
    16197 (Il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16197 (Il7r)
   04090 CD molecules [BR:mmu04090]
    16197 (Il7r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16197 (Il7r)
CD molecules [BR:mmu04090]
 Proteins
  16197 (Il7r)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 16197
NCBI-ProteinID: NP_032398
MGI: 96562
Ensembl: ENSMUSG00000003882
UniProt: P16872 Q5FW78 Q8C9W4
Structure
PDB: 
4NN5 4NN6 5J12 4NN7

Position
15 A1; 15 4.16 cM
AA seq 459 aa
MMALGRAFAIVFCLIQAVSGESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLLTCAFN
DSDINTANLEFQICGALLRVKCLTLNKLQDIYFIKTSEFLLIGSSNICVKLGQKNLTCKN
MAINTIVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYLKKVKHDVAYRPARGESNWTH
VSLFHTRTTIPQRKLRPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETPEPKNQGGWDP
VLPSVTILSLFSVFLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKTSLNVSFNP
ESFLDCQIHEVKGVEARDEVESFLPNDLPAQPEELETQGHRAAVHSANRSPETSVSPPET
VRRESPLRCLARNLSTCNAPPLLSSRSPDYRDGDRNRPPVYQDLLPNSGNTNVPVPVPQP
LPFQSGILIPVSQRQPISTSSVLNQEEAYVTMSSFYQNK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgatggctctgggtagagctttcgctatagttttctgcttaattcaagctgtttctgga
gaaagtggaaatgcccaggatggagacctagaagatgcagacgcggacgatcactccttc
tggtgccacagccagttggaagtggatggaagtcaacatttattgacttgtgcttttaat
gactcagacatcaacacagctaatctggaatttcaaatatgtggggctcttttacgagtg
aaatgcctaactcttaacaagctgcaagatatatattttataaagacatcagaattctta
ctgattggtagcagcaatatatgtgtgaagcttggacaaaagaatttaacttgcaaaaat
atggctataaacacaatagttaaagccgaggctccctctgacctgaaagtcgtttatcgc
aaagaagcaaatgattttttggtgacatttaatgcacctcacttgaaaaagaaatattta
aaaaaagtaaagcatgatgtggcctaccgcccagcaaggggtgaaagcaactggacgcat
gtatctttattccacacaagaacaacaatcccacagagaaaactacgaccaaaagcaatg
tatgaaatcaaagtccgatccattccccataacgattacttcaaaggcttctggagcgag
tggagtccaagttctaccttcgaaactccagaacccaagaatcaaggaggatgggatcct
gtcttgccaagtgtcaccattctgagtttgttctctgtgtttttgttggtcatcttagcc
catgtgctatggaaaaaaaggattaaacctgtcgtatggcctagtctccccgatcataag
aaaactctggaacaactatgtaagaagccaaaaacgagtctgaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatgaggtgaaaggcgttgaagccagggacgaggtg
gaaagttttctgcccaatgatcttcctgcacagccagaggagttggagacacagggacac
agagccgctgtacacagtgcaaaccgctcgcctgagacttcagtcagcccaccagaaaca
gttagaagagagtcacccttaagatgcctggctagaaatctgagtacctgcaatgcccct
ccactcctttcctctaggtcccctgactacagagatggtgacagaaataggcctcctgtg
tatcaagacttgctgccaaactctggaaacacaaatgtccctgtccctgtccctcaacca
ttgcctttccagtcgggaatcctgataccagtttctcagagacagcccatctccacttcc
tcagtactgaatcaagaagaagcgtatgtcaccatgtctagtttttaccaaaacaaatga

KEGG   Mus musculus (mouse): 18414
Entry
18414             CDS       T01002                                 

Gene name
Osmr, OS, OSMRB
Definition
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    18414 (Osmr)
   04151 PI3K-Akt signaling pathway
    18414 (Osmr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18414 (Osmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    18414 (Osmr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   18414 (Osmr)
SSDB
Motif
Pfam: LIFR_D2 fn3 EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 18414
NCBI-ProteinID: NP_035149
MGI: 1330819
Ensembl: ENSMUSG00000022146
Vega: OTTMUSG00000040092
UniProt: O70458 G3X8V6 Q3TRK8
Position
15 A1; 15 3.3 cM
AA seq 971 aa
MAFSVVLHPAFLLAVLSLRASRSEVLEEPLPLTPEIHKVSFQLKLQEVNLEWTVPALTHE
ELNMIFQIEISRLNISNTIWVENYSTTVKREEAVRWNWTSDIPLECVKHFIRIRALVDDT
KSLPQSSWGNWSSWKEVNAKVSVEPDKSLIFPKDKVLEEGSNVTICLMYGQNVYNVSCKL
QDEPIHGEQLDSHVSLLKLNNVVFLSDTGTNINCQATKGPKRIFGTVLFVSKVLEEPKNV
SCETRDFKTLDCSWEPGVDTTLTWRKQRFQNYTLCESFSKRCEVSNYRNSYTWQITEGSQ
EMYNFTLTAENQLRKRSVNINFNLTHRVHPKAPQDVTLKIIGATKANMTWKVHSHGNNYT
LLCQVKLQYGEVIHEHNVSVHMSANYLFSDLDPDTKYKAFVRCASANHFWKWSDWTQKEF
STPETAPSQALDVWRQVWSENGRRIVTLFWKPLLKSQANGKIISYNIVVENEAKPTESEH
YCVWAPALSTNLSLDLQPYKIRITANNSMGASPESLMVLSNDSGHEEVKEKTIKGIKDAF
NISWEPVSGDTMGYVVDWCAHSQDQRCDLQWKNLGPNTTSTTITSDDFKPGVRYNFRIFE
RSVEHKARLVEKQRGYTQELAPLVNPKVEIPYSTPNSFVLRWPDYDSDFQAGFIKGYLVY
VKSKEMQCNQPWERTLLPDNSVLCKYDINGSETKTLTVENLQPESLYEFFVTPYTSAGPG
PNETFTKVTTPDARSHMLLQIILPMTLCVLLSIIVCYWKSQWVKEKCYPDIPNPYKSSIL
SLIKSKKNPHLIMNVKDCIPDVLEVINKAEGSKTQCVGSGKLHIEDVPTKPPIVPTEKDS
SGPVPCIFFENFTYDQSAFDSGSHGLIPGPLKDTAHQLGLLAPPNKFQNVLKNDYMKPLV
ESPTEETSLIYVSQLASPMCGDKDTLATEPPVPVHGSEYKRQMVVPGSLASPSLKEDNSL
TSTVLLGQGEQ
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggctttctctgtggtccttcatccagccttcctcctggcagtgctgtccctgagggca
tcccgaagcgaagtcttggaggagcctttaccattgactcctgagatacataaagtttct
tttcaattgaaacttcaagaagtgaatttagaatggactgtcccagcccttactcatgaa
gaattaaacatgatatttcagatagagatcagtagactgaacatatccaacaccatctgg
gtggagaattatagcaccactgtgaagcgtgaagaagctgtgcgttggaactggacgtct
gatatccctttggagtgtgtcaaacatttcataagaatcagggctctggtagatgacacc
aagtcccttccacagagttcctggggcaactggagttcctggaaagaagttaatgcaaag
gtttccgttgaacctgataaatcattaatatttcctaaagacaaagtgttggaagaaggc
tccaatgtcaccatctgtctgatgtatgggcagaatgtatataatgtatcctgtaagttg
caagatgagccaatccatggagaacaacttgattcccacgtgtcattattaaaattgaac
aatgtagttttccttagtgacacagggacaaacatcaattgtcaagccacgaagggtcct
aaaagaatatttggtactgttctctttgtctcgaaagtgctcgaggaacctaagaatgtt
tcctgtgaaacccgagactttaagactttggactgttcatgggaacctggggtagatacg
actttgacttggcgtaaacaaagattccaaaactacactttatgtgaatcgttctctaag
agatgtgaggtttctaactacaggaactcctatacctggcaaatcactgaaggctcacag
gaaatgtataactttactctcacagctgaaaaccaactaaggaaaagaagtgtcaacatt
aattttaacctgacccatagagttcatccaaaggctccgcaggacgtcacccttaaaatt
ataggtgctacaaaagccaacatgacttggaaggttcactcccatggaaacaactacaca
cttttgtgtcaggttaaactccaatatggagaagtgattcatgagcacaatgtttctgtc
cacatgagcgcaaactacctcttcagtgatctggatccagacacaaagtacaaggctttt
gtgcgctgtgcaagtgccaaccacttctggaaatggagcgactggacccaaaaagagttc
agcacacccgagactgctccctcacaggctcttgatgtatggagacaagtgtggtcggag
aatggaagacgcattgtgactttattctggaagccactattaaaatcacaggccaatggc
aaaatcatatcctataatatagttgtagaaaatgaagccaaaccaactgagtcagaacac
tactgtgtctgggcaccagccctcagcacaaacctgagccttgacctgcaaccttacaag
attcgcatcacagccaacaacagcatgggggcatctcctgagtccttgatggtcctttct
aatgattctggacacgaagaggtcaaggaaaagacaattaaaggtataaaggatgcattc
aatatttcttgggagcccgtatctggagacacgatgggctatgttgtggactggtgtgca
cattcccaggaccaacgctgtgatttgcagtggaagaaccttggtcccaataccacaagc
accaccatcacctcagatgattttaaaccaggcgtccgttacaacttcagaatttttgaa
aggtctgtggaacacaaagctcggttagtagagaaacaaagaggatacacccaggaactg
gctcctttggtgaatccaaaagtggagattccttactcgacccctaactccttcgttcta
agatggccagattatgacagcgacttccaggctggttttataaaagggtacctcgtgtat
gtgaaatccaaggagatgcagtgcaaccaaccctgggaaaggaccctccttccagataat
tcagtcctctgtaaatacgacatcaatggctcagagacaaagacactcaccgtggaaaac
cttcagccagagtccctctatgagtttttcgtcactccgtacaccagcgctggcccagga
cccaatgaaacgttcacaaaggtcacaactccagatgcacgctcccacatgctgctgcag
atcatactacccatgaccctctgcgtcttgctcagcatcattgtctgctactggaaaagt
cagtgggtgaaggagaagtgctaccctgacattcccaatccgtacaagagcagcattctg
tcactcataaaatccaagaagaatcctcacttaataatgaatgtcaaagactgcattcca
gatgtccttgaagtgataaacaaagcagaaggcagcaagacacagtgtgtaggctctggg
aaacttcacattgaagatgtacccactaagccgccaatcgtgccaacagaaaaggattcc
tcagggcctgtgccctgcatcttctttgagaattttacttacgatcagtcagcttttgac
tctggttcccatggcctcattccaggtcccctaaaagacacagcacaccaacttggacta
ttggctccacctaacaagttccagaacgtattaaaaaatgactacatgaagcccctggtc
gaaagtccaactgaagaaactagcttgatttatgtgtcacagctggcttcacccatgtgc
ggagacaaggacacgcttgccacagaaccacccgtgccagtgcatggttcagagtataaa
aggcaaatggtagttcccgggagcctcgcatcaccttctctgaaggaggataacagcttg
acctcaacggtcctcttaggccaaggtgaacagtaa

KEGG   Mus musculus (mouse): 19116
Entry
19116             CDS       T01002                                 

Gene name
Prlr, AI987712, Pr, Pr-1, Pr-3, Prlr-rs1
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    19116 (Prlr)
   04151 PI3K-Akt signaling pathway
    19116 (Prlr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19116 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    19116 (Prlr)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    19116 (Prlr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    19116 (Prlr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   19116 (Prlr)
SSDB
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3
Other DBs
NCBI-GeneID: 19116
NCBI-ProteinID: NP_035299
MGI: 97763
Ensembl: ENSMUSG00000005268
Vega: OTTMUSG00000023932
UniProt: Q08501 Q8C5N1 Q3TNP6
Position
15 A1; 15 5.23 cM
AA seq 608 aa
MSSALAYMLLVLSISLLNGQSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYS
KEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIV
EPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFT
GHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDTTVWIIVAVLS
AVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDFPPTS
DCEDLLVEFLEVDDNEDERLMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLLSEKCE
EPQAYPPAFHIPEITEKPENPEANIPPTPNPQNNTPNCHTDTSKSTTWPLPPGQHTRRSP
YHSIADVCKLAGSPGDTLDSFLDKAEENVLKLSEDAGEEEVAVQEGAKSFPSDKQNTSWP
PLQEKGPIVYAKPPDYVEIHKVNKDGVLSLLPKQRENHQTENPGVPETSKEYAKVSGVTD
NNILVLVPDSRAQNTALLEESAKKVPPSLEQNQSEKDLASFTATSSNCRLQLGRLDYLDP
TCFMHSFH
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgtcatctgcacttgcttacatgctgcttgtcctcagcatcagcctcctgaatggacag
tcaccacctggaaaacctgaaatccacaaatgtcgttcccctgacaaggaaacattcacc
tgctggtggaatcctgggtcagatggaggactccccaccaattattcattgacatacagc
aaagaaggagagaaaaacacctatgaatgtccagactacaaaaccagtggccccaattcc
tgtttctttagcaagcagtacacttccatatggaaaatatacatcatcacagtaaatgcc
acgaacgaaatgggaagcagtacctcggatccactttatgtggatgtgacttacattgtt
gaaccagagcctcctcggaacctgactttagaagtgaaacaactaaaagacaaaaaaaca
tatctgtgggtaaaatggttgccacctaccataactgatgtaaaaactggttggtttaca
atggaatatgaaattcgattaaagtctgaagaagcagatgagtgggagatccacttcaca
ggtcatcaaacacaatttaaggtttttgacttatatccaggacaaaagtatcttgtccag
actcgctgcaagccagaccatggatactggagtagatggggccaggagaaatctattgaa
ataccaaatgacttcaccttgaaagacacaactgtgtggatcattgtggccgttctctct
gctgtcatctgtttgattatggtctgggcagtggctttgaagggttatagcatgatgacc
tgcatctttccaccagttccggggccaaaaataaaaggatttgatactcatctgctagag
aagggcaagtctgaagaactgctgagtgccttggggtgccaagactttccccccacttct
gactgtgaggacttgctggtggagttcttggaagtggatgacaatgaggacgagcggcta
atgccatcccattccaaagagtatccgggtcaaggtgttaaacccacacacctagatcct
gacagtgactctggtcatggaagctatgacagccattctcttttgtctgaaaagtgtgag
gagccccaggcctacccccctgccttccacatccctgagatcactgagaagccagagaat
cctgaggcaaatattcctcccaccccaaatccccaaaataacacccccaattgtcataca
gatacatccaaatctacaacatggcctttaccacctggccaacacacgcgcagatctcct
taccacagcattgccgatgtgtgcaagctagctggaagtcctggagatacactggactct
ttcttggacaaagcagaggaaaatgttctaaagttgtctgaagatgctggagaggaagaa
gtggctgtgcaagaaggggccaaaagcttcccttctgacaaacaaaacacatcttggcca
ccactccaggagaaaggccccattgtctatgctaaacccccagattacgtggagattcac
aaagtcaacaaagacggagtgctatcattactccccaagcagagagaaaaccaccagaca
gaaaaccctggggttcctgaaaccagtaaggagtatgccaaggtatctggggtcacggat
aacaacatcctggtgttagtgccagactcacgagcccagaacacagctttgcttgaggaa
tcagccaagaaggttccaccatcgcttgaacagaaccaatctgagaaagatctggccagc
tttactgcaacctcaagcaactgcagactccaactgggcaggctggattacctggatcct
acgtgcttcatgcactcctttcactga

DBGET integrated database retrieval system