KEGG   Mus musculus (mouse): 12990
Entry
12990             CDS       T01002                                 

Gene name
Csn1s1, AA959832, AW212882, C, Csna
Definition
(RefSeq) casein alpha s1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Casein NupH_GANP FANCL_d3 Dimeth_Pyl FAM110_C RNA_pol_Rbc25 BRF1
Other DBs
NCBI-GeneID: 12990
NCBI-ProteinID: NP_031810
MGI: 88540
Ensembl: ENSMUSG00000070702
Vega: OTTMUSG00000054070
UniProt: P19228
Position
5 E1; 5 43.56 cM
AA seq 313 aa
MKLLILTCLVAAAFAMPRLHSRNAVSSQTQQQHSSSEEIFKQPKYLNLNQEFVNNMNRQR
ALLTEQNDEIKVTMDAASEEQAMASAQEDSSISSSSEESEEAIPNITEQKNIANEDMLNQ
CTLEQLQRQFKYNQLLQKASLAKQASLFQQPSLVQQASLFQQPSLLQQASLFQQPSMAQQ
ASLLQQLLLAQQPSLALQVSPAQQSSLVQQAFLAQQASLAQKHHPRLSQSYYPHMEQPYR
MNAYSQVQMRHPMSVVDQALAQFSVQPFPQIFQYDAFPLWAYFPQDMQYLTPKAVLNTFK
PIVSKDTEKTNVW
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaactcctcatcctcacctgcctcgtggctgctgcttttgctatgcccagacttcat
agtagaaatgcagttagcagtcaaactcagcaacagcatagcagcagtgaggaaattttt
aaacaaccaaagtatctcaacctaaatcaggaattcgtcaacaacatgaacagacagaga
gcacttctgacagaacagaacgatgaaatcaaggtaactatggatgcagcatctgaggaa
caagcaatggcaagtgctcaggaagactcttcaatcagctcatcaagtgaggaatctgag
gaagctattcccaatatcactgagcagaaaaacattgcaaatgaagacatgctcaaccag
tgcaccctggaacagcttcagagacagtttaagtacaaccaacttctccagaaagcttcc
ctggctaagcaagcttccctgtttcagcaaccttccctggtacagcaagcttccctgttt
cagcaaccttccctgcttcagcaagcttccctgtttcagcaaccttccatggctcagcaa
gcttccctgctacagcaacttctcctggcccagcaaccttccctggcactgcaagtttcc
ccagcacagcaatcttccctggtacagcaagctttcctggcacagcaagcttccctggca
cagaaacatcatccaagactgagccagtcctactatccacatatggaacagccttacaga
atgaatgcatacagccaagttcaaatgagacatcctatgagtgtagtggatcaggcactg
gcccagttctctgttcagcccttcccacaaatcttccagtatgatgcctttcccctttgg
gcttactttccacaggatatgcagtaccttactcccaaagctgtccttaacaccttcaag
cccattgtctccaaggatactgaaaaaaccaatgtgtggtga

DBGET integrated database retrieval system