KEGG   Mus musculus (house mouse): 12992
Entry
12992             CDS       T01002                                 
Symbol
Csn1s2b, AW987150, Csnd, Csne
Name
(RefSeq) casein alpha s2-like B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Casein AAA_8
Other DBs
NCBI-GeneID: 12992
NCBI-ProteinID: NP_034103
MGI: 105312
Ensembl: ENSMUSG00000061388
UniProt: P02664
Position
5:87955980..87972280
AA seq 143 aa
MKFIILTCLLAVALAKQRMEQYISSEESMDNSQENFKQNMDVAFFPSQETVENIYIPQME
SVEAPMKVSDIISQQQYNQKMMDMSVSAREKTVMTEESKNIQDYMNKMKRYSKITWPQFV
KLLHQYQKTMTPWSYYPSTPSQV
NT seq 432 nt   +upstreamnt  +downstreamnt
atgaagttcatcattcttacttgccttttggccgttgctcttgcaaagcagaggatggag
caatacatctccagtgaggagtccatggataactctcaagaaaactttaagcagaatatg
gatgtggccttttttcccagtcaggaaactgtagagaacatttacattccccaaatggaa
tctgttgaagctcccatgaaggtatctgacatcatttctcagcaacaatacaaccagaaa
atgatggacatgagtgtgagtgccagagagaaaactgtgatgactgaagaaagtaagaac
atccaagactacatgaacaaaatgaaacgatacagcaagatcacctggccacagtttgta
aagcttctccatcaataccagaaaaccatgaccccgtggagctattacccatctaccccc
agccaggtttga

DBGET integrated database retrieval system