KEGG   Mus musculus (mouse): 12994
Entry
12994             CDS       T01002                                 

Gene name
Csn3, AW208918, CSN, CSN10, Cs, Csnk
Definition
(RefSeq) casein kappa
  KO
K17282  kappa-casein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12994 (Csn3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   12994 (Csn3)
SSDB
Motif
Pfam: Casein_kappa
Other DBs
NCBI-GeneID: 12994
NCBI-ProteinID: NP_031812
MGI: 107461
Ensembl: ENSMUSG00000001622
Vega: OTTMUSG00000025838
UniProt: P06796
Position
5 E1; 5 43.56 cM
AA seq 181 aa
MMRNFIVVVNILALTLPFLAAEIQNPDSNCRGEKNDIVYDEQRVLYTPVRSVLNFNQYEP
NYYHYRPSLPATASPYMYYPLVVRLLLLRSPAPISKWQSMPNFPQSAGVPYAIPNPSFLA
MPTNENQDNTAIPTIDPITPIVSTPVPTMESIVNTVANPEASTVSINTPETTTVPVSSTA
A
NT seq 546 nt   +upstreamnt  +downstreamnt
atgatgaggaattttatcgtagttgtgaatattctggcattaactctgccctttttggct
gcagagatacaaaacccagattcaaactgccgtggtgagaagaatgacatagtgtacgat
gagcaaagagtcctgtacacaccagtccgctccgtcctgaacttcaatcaatatgaacct
aattactaccactacaggccatctttgcctgctactgctagcccatacatgtactaccca
cttgttgttagactacttctgcttaggtctccagccccaatctccaaatggcaatcaatg
ccaaatttcccccagtctgctggagtaccttatgccattccaaacccatcctttcttgcc
atgcctacaaatgaaaatcaggataacaccgccattccaaccatcgaccccattactccc
attgtgtccacaccagttcctaccatggagtcaatagtaaatactgtggccaatcctgaa
gcttccacagtgtctatcaatacccctgagactactacagtcccagtgtcctcaactgca
gcataa

DBGET integrated database retrieval system