KEGG   Mus musculus (house mouse): 12995
Entry
12995             CDS       T01002                                 
Symbol
Csnk2a1, CK2, Csnk2a1-rs4
Name
(RefSeq) casein kinase 2, alpha 1 polypeptide
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05162  Measles
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    12995 (Csnk2a1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12995 (Csnk2a1)
   04064 NF-kappa B signaling pathway
    12995 (Csnk2a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    12995 (Csnk2a1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    12995 (Csnk2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12995 (Csnk2a1)
  09172 Infectious disease: viral
   05162 Measles
    12995 (Csnk2a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12995 (Csnk2a1)
   05020 Prion disease
    12995 (Csnk2a1)
   05022 Pathways of neurodegeneration - multiple diseases
    12995 (Csnk2a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12995 (Csnk2a1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    12995 (Csnk2a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12995 (Csnk2a1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  CK2 family
   12995 (Csnk2a1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Kinase
    12995 (Csnk2a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Pkinase_fungal Kdo Choline_kinase DUF5898 FTA2
Other DBs
NCBI-GeneID: 12995
NCBI-ProteinID: NP_031814
MGI: 88543
Ensembl: ENSMUSG00000074698
UniProt: Q60737
Position
2:152067851..152123772
AA seq 391 aa
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaacacacacagaccc
cgagagtactgggattatgaatcacatgtggtggaatgggggaatcaagatgactatcag
cttgttcgaaaattaggtaggggcaaatacagtgaagtgtttgaagccatcaacatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaaaaagaagaaaattaagcgt
gaaataaagattttggagaatttgagaggtgggcccaacatcatcacacttgcagacatt
gtaaaagaccctgtgtcacgaacccctgccttggtttttgaacatgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgacattcgattttacatgtatgaaatt
ctgaaagccctggattattgtcacagcatggggattatgcacagagatgtgaaaccccat
aatgtcatgattgatcatgagcacagaaagcttcggctaatagactggggtttagctgag
ttttaccatccaggccaagagtataatgtccgagttgcttctcgatatttcaaaggtcca
gagctacttgtagattatcagatgtacgattatagtttggatatgtggagcttgggttgt
atgctggccagtatgatcttccggaaggagccatttttccatggacatgacaattatgat
cagttggtgaggatagccaaggttctgggaacagaagatttatatgactatattgacaag
tacaacattgaattagatccacgtttcaacgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcatcttgtcagccctgaggccttggatttt
ctggacaagctgcttcgatatgaccaccagtcacggctcactgcaagagaggccatggag
cacccttacttctacactgttgtgaaggaccaggctcgaatgagttccactagcatggca
gggggcagcacacctgtcagcagcgccaatatgatgtcagggatttcttcagtgccaact
ccttcaccccttggacctctggcaggctcaccagtgattgccgctgccaactcacttggg
atacctgttccagctgctgctggcgctcagcagtaa

DBGET integrated database retrieval system