KEGG   Mus musculus (mouse): 13000Help
Entry
13000             CDS       T01002                                 

Gene name
Csnk2a2, 1110035J23Rik, C77789, CK2
Definition
(RefSeq) casein kinase 2, alpha prime polypeptide
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05162  Measles
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    13000 (Csnk2a2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13000 (Csnk2a2)
   04064 NF-kappa B signaling pathway
    13000 (Csnk2a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    13000 (Csnk2a2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    13000 (Csnk2a2)
 09160 Human Diseases
  09167 Infectious diseases
   05162 Measles
    13000 (Csnk2a2)
   05168 Herpes simplex infection
    13000 (Csnk2a2)
   05169 Epstein-Barr virus infection
    13000 (Csnk2a2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13000 (Csnk2a2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    13000 (Csnk2a2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13000 (Csnk2a2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  CK2 family
   13000 (Csnk2a2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  90S particles
   Kinase
    13000 (Csnk2a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Choline_kinase Kinase-like ABC1
Motif
Other DBs
NCBI-GeneID: 13000
NCBI-ProteinID: NP_034104
MGI: 88547
Ensembl: ENSMUSG00000046707
Vega: OTTMUSG00000061759
UniProt: O54833 Q8CDH5 Q545V8
Position
8 C5; 8 47.12 cM
AA seq 350 aa AA seqDB search
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNY
DQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCAENTVLSSGLTAAR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcccggccgcgggcagtcgggcccgggtctacgccgaggtgaacagcctgagg
agccgcgagtactgggactacgaagcccacgtcccgagctggggtaatcaagatgattac
caactggttcgaaaacttggtcggggcaagtatagtgaagtatttgaggccattaacatc
accaacaatgagagggtggttgtaaaaattctcaagccagtgaagaaaaagaagataaaa
cgagaggttaagattctggagaaccttcgtggtggaacaaatatcattaagctgattgac
actgtaaaggaccctgtgtcaaagacaccagctttggtatttgaatatatcaataataca
gattttaagcaactctaccagatcctgactgactttgatatccggttttatatgtatgaa
ctacttaaagctctggattactgccacagcaagggaatcatgcacagggatgtgaaacct
cacaatgtcatgatagatcaccaacaaaaaaagctccgactgattgattggggtctggca
gagttctatcatcctgctcaggagtacaatgttcgagtggcctcgaggtacttcaaggga
ccagagctccttgtggactatcagatgtatgattatagcttggacatgtggagcttgggc
tgcatgttagcgagcatgatattccgaaaggagccattcttccacgggcaggacaactat
gaccagcttgttcgaattgccaaggttctggggacagatgaactatatggttatctgaag
aagtaccacatagacctagatccacacttcaatgatatcctgggacaacattcacggaag
cgctgggaaaactttatccatagtgagaacaggcaccttgtcagcccggaggccctagat
cttcttgacaagctcctgcggtacgaccatcaacagagattgaccgccaaagaggccatg
gagcacccatatttctacccggtggtgaaggagcagtcccagccttgtgctgagaacacc
gtgctttccagtggtctcaccgcagcacgatga

DBGET integrated database retrieval system