KEGG   Mus musculus (house mouse): 13001
Entry
13001             CDS       T01002                                 
Symbol
Csnk2b, CK_II_beta
Name
(RefSeq) casein kinase 2, beta polypeptide
  KO
K03115  casein kinase II subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05162  Measles
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    13001 (Csnk2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13001 (Csnk2b)
   04064 NF-kappa B signaling pathway
    13001 (Csnk2b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    13001 (Csnk2b)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    13001 (Csnk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13001 (Csnk2b)
  09172 Infectious disease: viral
   05162 Measles
    13001 (Csnk2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13001 (Csnk2b)
   05020 Prion disease
    13001 (Csnk2b)
   05022 Pathways of neurodegeneration - multiple diseases
    13001 (Csnk2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    13001 (Csnk2b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    13001 (Csnk2b)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Kinase
    13001 (Csnk2b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     13001 (Csnk2b)
SSDB
Motif
Pfam: CK_II_beta CCDC24
Other DBs
NCBI-GeneID: 13001
NCBI-ProteinID: NP_001290374
MGI: 88548
Ensembl: ENSMUSG00000024387
UniProt: P67871
Position
17:complement(35335171..35341029)
AA seq 215 aa
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa
ttcttctgtgaggtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtgcctcactatcgacaagctctggacatgatcttagacctggaacctgatgaa
gagctggaagacaaccccaaccagagcgacttgatcgaacaggcagctgagatgctttat
gggttgatccacgcccgctacatcctcaccaaccgaggcatcgcacaaatgttggaaaag
taccagcagggagactttggctactgtcctcgtgtatactgtgagaaccagccaatgctt
cctatcggcctttcagacatcccaggcgaggccatggtgaaactctactgccccaagtgc
atggacgtgtacacacccaagtcctccagacaccaccacacggacggcgcatacttcggc
actggtttccctcacatgctcttcatggtgcatccagagtaccggcccaagcgacctgcc
aaccagtttgtacccaggctctatggtttcaagatccatccaatggcttaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagactattcgctga

DBGET integrated database retrieval system