KEGG   Mus musculus (mouse): 13002
Entry
13002             CDS       T01002                                 

Gene name
Dnajc5, 2610314I24Rik, AU018536, C, Csp
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13002 (Dnajc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    13002 (Dnajc5)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   13002 (Dnajc5)
SSDB
Motif
Pfam: DnaJ Baculo_F EMP70
Other DBs
NCBI-GeneID: 13002
NCBI-ProteinID: NP_001258513
MGI: 892995
Ensembl: ENSMUSG00000000826
Vega: OTTMUSG00000016739
UniProt: P60904
Structure
PDB: 
2CTW

Position
2 H4; 2 103.63 cM
AA seq 198 aa
MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI
NNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVVCGLLTCCY
CCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATE
TTQLTADSHPSYHTDGFN
NT seq 597 nt   +upstreamnt  +downstreamnt
atggccgaccagaggcagcgctcactctctacttccggggaatcattataccatgttctt
ggactggacaagaatgcaacctcagatgacattaaaaagtcctatcggaagctggccctg
aagtatcaccctgacaagaaccctgataacccagaggctgcagacaagtttaaggagatt
aacaacgcacacgccatcctgacagacgccacgaaaagaaacatttatgacaagtatggc
tcgctggggctctatgtggcggagcagtttggggaggagaacgtcaacacctacttcgta
ctctccagctggtgggccaaggcgctgtttgttgtttgtggcctcctcacctgctgctac
tgctgctgctgtttgtgctgttgctttaactgctgctgtgggaaatgcaagcccaaggca
cctgagggtgaggagacagaattctacgtatcccctgaagacttggaggcacagctgcag
tctgatgaaagggaggctacagacacaccgatcgtcatacagccagcatctgccacagag
accacccagctgacagctgactcccaccccagctatcacaccgacgggttcaactaa

KEGG   Mus musculus (mouse): 15502
Entry
15502             CDS       T01002                                 

Gene name
Dnaja1, HSJ-2, Hsj, Hsj2, Nedd, Nedd7
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A1
  KO
K09502  DnaJ homolog subfamily A member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15502 (Dnaja1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15502 (Dnaja1)
   04131 Membrane trafficking [BR:mmu04131]
    15502 (Dnaja1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   15502 (Dnaja1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    15502 (Dnaja1)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Other DBs
NCBI-GeneID: 15502
NCBI-ProteinID: NP_001158143
MGI: 1270129
Ensembl: ENSMUSG00000028410
Vega: OTTMUSG00000006566
UniProt: P63037 Q5NTY0
Position
4; 4 A5
AA seq 397 aa
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggtgaaagaaaccacttactacgatgttttgggggtaaaacccaatgccacccaggaa
gaattgaaaaaggcatatagaaaattggccttgaagtaccaccctgataagaatccaaat
gaaggggaaaagtttaaacagatttctcaagcttatgaagttcttgctgattccaaaaaa
agggaactatatgataaaggaggggagcaggcgattaaagagggcggagcaggtggtggt
tttggctcacccatggatatctttgatatgttctttggaggaggaggaagaatgcaaaga
gaaaggagaggtaaaaatgttgttcatcagctctcagtgaccttagaagacttatataat
ggtgcaacaagaaaactggctctgcaaaagaatgtgatttgtgacaaatgtgaaggccga
ggtggtaagaaaggagcagtagagtgctgtcccaactgccgggggacaggtatgcagata
aggattcatcagattggaccaggaatggttcagcaaattcagtcagtgtgcatggagtgc
cagggtcatggagaacgcatcagtccaaaagacagatgtaaaagctgcaatggaagaaaa
atagttcgagagaagaaaattttagaagttcatattgataaaggcatgaaagatggtcag
aagataacattccacggtgaaggagaccaagaaccaggactggagccaggagatattatc
attgtgttagatcagaaggaccatgctgtttttacaaggcgaggagaagaccttttcatg
tgtatggacatacagctggttgaagcattgtgcggcttccaaaagccaatatctactctt
gacaaccgaaccatagtcatcacctctcatccaggtcagattgtcaagcatggggatata
aaatgtgtgctaaatgaaggtatgccaatataccgtcggccatatgaaaagggacgtcta
atcattgagtttaaggtaaactttcctgaaaatggctttctctctcctgataaactctct
ttgctggaaaaactccttcctgaaaggaaggaagtagaagagactgatgaaatggatcag
gtagaactggtggactttgatccaaatcaggaaagacggcgtcattataatggagaagcg
tatgaggatgatgaacatcaccccagaggtggcgttcagtgtcagacctcttaa

KEGG   Mus musculus (mouse): 231098
Entry
231098            CDS       T01002                                 

Gene name
Dnajc5g, 4922503E23Rik
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5 gamma
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    231098 (Dnajc5g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    231098 (Dnajc5g)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   231098 (Dnajc5g)
SSDB
Motif
Pfam: DnaJ
Other DBs
NCBI-GeneID: 231098
NCBI-ProteinID: NP_001334253
MGI: 3045263
Ensembl: ENSMUSG00000053856
Vega: OTTMUSG00000047923
UniProt: A0A087WQK2
Position
5; 5 B1
AA seq 139 aa
MPLTYDATQRLSRTGKSLYAVLELKKGAETADIKKAYRKLALQYHPDKNPDNPLAAEIFK
EINTAHAILTDPTKKKIYDRHGSLGLYLYDHFGEEGVRFYFIVNSCWFKVLAQQESPTLS
PLDTLKKEESSPVSTLTQI
NT seq 420 nt   +upstreamnt  +downstreamnt
atgcctcttacgtatgacgcaacccagcgactatctagaactgggaaaagcctctatgca
gtgctggaactgaagaagggtgctgagactgcagacatcaaaaaagcctacaggaaactg
gccttgcaatatcatccagacaagaatccagataaccctttagcagcagaaatcttcaaa
gagatcaacacagcccatgccatactcaccgaccctacaaaaaagaagatctatgaccgg
cacggctcactaggattatacctgtatgaccattttggtgaagaaggtgtccgattctat
tttatagtgaacagttgttggttcaaggtgctggcccagcaagagtccccgacactcagc
ccactggatacattgaagaaggaagaaagtagccctgtctctacactcacccagatttga

KEGG   Mus musculus (mouse): 56445
Entry
56445             CDS       T01002                                 

Gene name
Dnaja2, 1500017M13Rik, 2010206B19Rik, DNAJ, DNJ, DNJ3, Dnaj3, HI, HIRIP4, PRO3, PRO3015, mDj3
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A2
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56445 (Dnaja2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56445 (Dnaja2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    56445 (Dnaja2)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   56445 (Dnaja2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    56445 (Dnaja2)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Other DBs
NCBI-GeneID: 56445
NCBI-ProteinID: NP_062768
MGI: 1931882
Ensembl: ENSMUSG00000031701
Vega: OTTMUSG00000061420
UniProt: Q9QYJ0
Position
8; 8 C3
AA seq 412 aa
MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNP
EKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPL
KVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQ
QMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQA
PGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPP
GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPE
VPNVIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcgaacgtggccgacacgaagctgtacgacatcctgggcgtccctcccggcgctagc
gagaacgagctgaagaaggcataccgaaagttagccaaagaataccaccctgataagaat
ccaaatgctggagacaaatttaaagaaataagttttgcatatgaagtattgtcaaatcca
gagaagcgagagctgtatgacagatatggagaacaaggcctacgggaaggcagcggcgga
ggcggtggcatggatgatatcttctcacatatttttggtggaggattgtttggctttatg
ggcaatcagagtagaagtcgaaatggcagaagaagaggcgaggacatgatgcatccacta
aaagtatctttagaagacctgtacaatggcaagacaaccaaactacaacttagcaagaat
gtgctctgtagtgcatgcagtggccaaggtgggaagtctggagctgttcagaaatgcagc
gcttgtcggggtcgaggtgtgcgcattatgatcagacagctggctccaggaatggtgcag
cagatgcagtccgtgtgctccgactgtaatggagaaggggaggtcatcaatgaaaaagac
cgctgtaaaaaatgtgaagggaagaaggtaatcaaagaagtcaagattctggaagtccat
gtagacaaaggcatgaaacatggacagaggattacgttcactggggaagcagaccaggct
ccaggagtggaacctggagatattgttcttttgctacaggaaaaagaacatgaggtgttc
cagagagatgggaatgatttgcatatgacatataagataggacttgttgaagctttatgt
ggatttcagttcacatttaaacatcttgatgctcgtcagattgtggtgaaatacccccct
ggcaaagtaattgaaccaggatgtgttcgtgttgttcgaggtgaaggaatgccacagtat
cgtaatccctttgaaaagggtgatctctacataaagtttgatgtacagtttcctgagaat
aactggatcaacccagacaaactttctgaattagaagatctcctgccatctagaccagaa
gttcctaatgttattggagagacagaagaagtggagcttcaggaatttgatagcactcga
ggctctggcggtggtcagagacgtgaagcctataatgatagctctgatgaagaaagtagc
agccatcatggacctggagtgcagtgtgcccatcagtaa

KEGG   Mus musculus (mouse): 56709
Entry
56709             CDS       T01002                                 

Gene name
Dnajb12, Dj10, mDj10
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B12
  KO
K09518  DnaJ homolog subfamily B member 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56709 (Dnajb12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56709 (Dnajb12)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   56709 (Dnajb12)
SSDB
Motif
Pfam: DUF1977 DnaJ TPR_2
Other DBs
NCBI-GeneID: 56709
NCBI-ProteinID: NP_064349
MGI: 1931881
Ensembl: ENSMUSG00000020109
Vega: OTTMUSG00000034094
UniProt: Q9QYI4
Position
10; 10 B4
AA seq 376 aa
MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSALIESLNQKPQSTGDH
PQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVKRVKQCKDYYEILGVSR
SASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQ
AARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQ
GDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHKRVTDHLNVAYYVAD
TFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMG
TPSCNRLSEVQASLHG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggaatccaacaaggatgaagccgagcgctgtatcagcatcgccctcaaggccatccaa
agcaaccagcccgagcgggcgctgcgcttcctggagaaggcgcagcggctctacccgacg
ccacgagtcagcgcactgatcgagtccctcaaccaaaaaccacagtccaccggtgatcac
cctcaacccacagacactacccataccaccaccaagaaggcaggcgggaccgaaaccccc
tcagccaacggcgaggcaggaggaggggagagcgccaagggctatacctcagagcaggtg
gcagctgtgaaaagggtcaagcagtgtaaagattactatgagatccttggggtaagcaga
agtgcctcagatgaggacctaaagaaggcctaccgcaagctggccctcaagttccatcca
gacaagaaccatgcgcctggggccactgaagctttcaaagccattggcacagcgtatgcc
gtactcagcaacccagagaaaaggaaacagtacgaccagtttggtgatgacaagagccag
gctgcccggcacggccacagccacggggacttccaccgaggctttgaggctgacatctcc
ccagaagacctctttaacatgttctttggtggcggctttccttccagtaacgttcatgtc
tacagcaatggccgaatgcggtacacctaccagcagaggcaagaccgcagagacaaccag
ggtgatggcgggctaggagtgttcgtgcagctgatgcccatcctcatcctcatcctcgtg
tctgcgctcagccagctcatggtgtccagtcctccctacagcctgagcccgagaccgtca
gtgggccacatccacaagcgagtcactgaccacctgaacgtcgcctactacgtggcagac
accttctccgaagagtacacgggctccagcctcaaaacagtggaacggaatgtagaggat
gactacatcgccaacctgcgcaacaactgctggaaggagaagcagcagaaggaaggcttg
ctgtaccgagcccgctactttggtgacacagacatgtaccacagagcacagaagatgggc
accccgagttgcaatcggctgtcagaggtgcaggcctccctgcatggatag

KEGG   Mus musculus (mouse): 56812
Entry
56812             CDS       T01002                                 

Gene name
Dnajb2, 2700059H22Rik, Dnajb, Dnajb10, Hsj1, mDj8
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B2
  KO
K09508  DnaJ homolog subfamily B member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56812 (Dnajb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56812 (Dnajb2)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   56812 (Dnajb2)
SSDB
Motif
Pfam: DnaJ UIM
Other DBs
NCBI-GeneID: 56812
NCBI-ProteinID: NP_001153355
MGI: 1928739
Ensembl: ENSMUSG00000026203
Vega: OTTMUSG00000048595
UniProt: Q9QYI5
Position
1; 1 C4
AA seq 324 aa
MASYYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYDRYGREGLTGAGSGPSRSETGGAGPGFTFTFRSPEEVFREFFGSGDPFSELFDDL
GVFSELQNQGPRLTGPFFTFSSSFPANSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVSINGVPDDLALGLELSRREQQPSVAPGLGVMQVRPTS
LSRPPDHDLSEDEDLQLAMAYSLSEMEAAGQKPAGGRGAQQRQHGQPKAQHRDLDVGGTH
KSVRGEAAKLSPSSEEKASRCHIL
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcatcctactacgagattctagacgtaccgcggagtgcgtcccctgatgacatcaag
aaggcgtaccgaaagaaggctctgcagtggcacccagacaagaacccggataataaagaa
tttgctgaaaaaaaatttaaggaggtggcagaggcctatgaagtactatctgacaagcac
aaacgggagatctatgaccgctatggccgggaagggctgaccggggcaggaagtggtcct
tctcgatcggaaactggtggtgcggggcctggcttcacattcaccttccgtagccccgag
gaagtcttccgggagttcttcgggagcggagaccctttttcagagctctttgatgacttg
ggtgtcttctcggagcttcagaaccagggtccccgactcacgggccctttcttcactttc
tcttcttcctttcctgccaactccgatttctcctcctcatctttctccttcagcccgggg
gctggtgctttccgctccgtttctacgtccaccacctttgtccaaggccgccgcatcacc
acacgcagaatcatggagaacgggcaggagcgggtagaagtggaagaggatggacaactg
aagtcagtgtcaatcaatggtgtcccagatgacctggcactaggcttggagctgagccgt
cgtgagcagcaaccttcagttgcccctgggctgggggtcatgcaggtccggccgacctct
ctctctcgtccccctgaccatgatctttctgaggatgaggacctgcagctcgccatggct
tacagcctgtcagagatggaggcggctgggcagaagccagcaggtgggcggggggcacag
caacgacagcatgggcagcccaaggcccagcaccgagaccttgacgtggggggcacccat
aagagtgtgaggggcgaggcagctaaactcagcccgtcctcagaggagaaggcctctcgc
tgccacattctctga

KEGG   Mus musculus (mouse): 66326
Entry
66326             CDS       T01002                                 

Gene name
Dnajc5b, 1700008A05Rik
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C5 beta
  KO
K09525  DnaJ homolog subfamily C member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66326 (Dnajc5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    66326 (Dnajc5b)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   66326 (Dnajc5b)
SSDB
Motif
Pfam: DnaJ EMP70
Other DBs
NCBI-GeneID: 66326
NCBI-ProteinID: NP_001157008
MGI: 1913576
Ensembl: ENSMUSG00000027606
Vega: OTTMUSG00000027803
UniProt: Q9CQ94
Position
3; 3 A2
AA seq 199 aa
MACNAPNQRQRTLSTSGESLYEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEK
FKEINNAHTILTDTSKRNIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLL
TGCYFCCCLCCCCNCCCGHCRPKSSTPEEEFYVSPEDLEEQIRTDMEKDMDFPVVLQPTN
TNEKTQLIREGSRSYCTDS
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcatgtaacgcacccaaccaaagacagcggactttgtcaacatcaggagaaagtcta
tatgaaattcttggtctgcataagggagcatcatgtgaagaaattaagaaaacctacaga
aaattagccctgcgacaccatccagacaagaatccagatgacccatctgctgctgagaag
tttaaagaaatcaacaacgcccacacaatcctcaccgacacctcaaagagaaacatatat
gacaagtatggatcgctgggactctacgtggctgaacaatttggagatgaaaacgttaac
acatacttcatgttgtcaagctggtgggcaaagaccctgttcatcatcattggcctcttg
accggctgctatttttgttgctgcctttgctgctgctgcaactgttgttgtggacattgt
cggcccaaatcatcgacaccagaagaggagttctatgtgtcaccagaggaccttgaggag
cagatcagaactgacatggagaaagatatggactttccagttgttctccagcctacaaat
acaaatgagaaaacacagctaatcagagaaggatctcgaagttactgcacagactcttaa

KEGG   Mus musculus (mouse): 81489
Entry
81489             CDS       T01002                                 

Gene name
Dnajb1, 0610007I11Rik, DjB1, HSPF1, Hdj1, Hsp, Hsp40
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B1
  KO
K09507  DnaJ homolog subfamily B member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    81489 (Dnajb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    81489 (Dnajb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    81489 (Dnajb1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   81489 (Dnajb1)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 81489
NCBI-ProteinID: NP_061278
MGI: 1931874
Ensembl: ENSMUSG00000005483
Vega: OTTMUSG00000061608
UniProt: Q9QYJ3 Q3TU79
Position
8; 8 C2
AA seq 340 aa
MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGGSPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRN
GEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLRVSLEEIYSGCT
KKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLK
DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE
GLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTILEQVLPI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggcaaggactactatcagacgctgggcctggcccgcggcgcgtccgacgacgagatc
aagcgagcctaccgccgccaggcgctgcgctaccacccggacaagaacaaggagcccggc
gctgaggagaagttcaaggagatcgccgaggcctacgacgtgctcagcgacccgcgcaag
cgcgagattttcgaccgctatggagaggaaggcctgaagggtggtagccccagtggagga
agcagtggtggtgctaatggtacctctttcagctacacattccacggagacccccatgcc
atgtttgctgagttcttcggtggcagaaacccctttgataccttttttgggcagcgcaac
ggggaagaaggcatggacattgatgacacattctctagctttccaatgggtatgggtggc
ttcaccaacatgaactttggacgttcccgcccttctcaagagcccacccggaagaagcaa
gatcctccagtcacccatgaccttcgggtctcccttgaagagatctacagcggctgtacc
aagaagatgaaaatctcccacaagcggctgaaccctgatggaaagagcattcgaaatgaa
gataagatcctgaccatcgaagtgaagaggggctggaaagaagggaccaaaatcaccttt
cccaaggaaggggaccagacctcgaacaacattccagcagacatcgtctttgttttaaag
gacaagccacacaatatcttcaagagagatggttctgatgtcatctatccagccaggatt
agccttcgggaggctctctgtggttgcactgtgaatgtccctactctggacggcaggacc
atccctgttgtattcaaagatgtcatcaggcctggtatgcggcggaaagtccctggagaa
ggcctccctctccccaaaacacctgagaaacgtggagaccttgttatcgagtttgaagtg
atcttcccggaaaggattcccgtctcatccagaaccatcctggagcaggttcttcccata
tag

DBGET integrated database retrieval system