KEGG   Mus musculus (house mouse): 13004
Entry
13004             CDS       T01002                                 
Symbol
Ncan, C230035B04, Cspg3, Cspg3-rs, Tgfbit
Name
(RefSeq) neurocan
  KO
K06794  neurocan core protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    13004 (Ncan)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13004 (Ncan)
   04091 Lectins [BR:mmu04091]
    13004 (Ncan)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   13004 (Ncan)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   13004 (Ncan)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   13004 (Ncan)
SSDB
Motif
Pfam: Xlink Lectin_C Sushi V-set EGF hEGF I-set EGF_2
Other DBs
NCBI-GeneID: 13004
NCBI-ProteinID: NP_031815
MGI: 104694
Ensembl: ENSMUSG00000002341
UniProt: P55066 A0A0R4IZX5
Position
8:complement(70545735..70573494)
AA seq 1268 aa
MGAGSVWASGLLLLWLLLLVAGDQDTQDTTATEKGLRMLKSGSGPVRAALAELVALPCFF
TLQPRLSSLRDIPRIKWTKVQTASGQRQDLPILVAKDNVVRVAKGWQGRVSLPAYPRHRA
NATLLLGPLRASDSGLYRCQVVKGIEDEQDLVTLEVTGVVFHYRAARDRYALTFAEAQEA
CRLSSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSYG
RRDPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCQRQGAALASVGQLHLAWHEGL
DQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPAPGARFDAYCFRAHHH
TAQHGDSEIPSSGDEGEIVSAEGPPGRELKPSLGEQEVIAPDFQEPLMSSGEGEPPDLTW
TQAPEETLGSTPGGPTLASWPSSEKWLFTGAPSSMGVSSPSDMGVDMEATTPLGTQVAPT
PTMRRGRFKGLNGRHFQQQGPEDQLPEVAEPSAQPPTLGATANHMRPSAATEASESDQSH
SPWAILTNEVDEPGAGSLGSRSLPESLMWSPSLISPSVPSTDSTPSAKPGAAEAPSVKSA
IPHLPRLPSEPPAPSPGPSEALSAVSLQASSADGSPDFPIVAMLRAPKLWLLPRSTLVPN
MTPVPLSPASPLPSWVPEEQAVRPVSLGAEDLETPFQTTIAAPVEASHRSPDADSIEIEG
TSSMRATKHPISGPWASLDSSNVTMNPVPSDAGILGTESGVLDLPGSPTSGGQATVEKVL
ATWLPLPGQGLDPGSQSTPMEAHGVAVSMEPTVALEGGATEGPMEATREVVPSTADATWE
SESRSAISSTHIAVTMARAQGMPTLTSTSSEGHPEPKGQMVAQESLEPLNTLPSHPWSSL
VVPMDEVASVSSGEPTGLWDIPSTLIPVSLGLDESDLNVVAESPSVKGFWEEVASGQEDP
TDPCENNPCLHGGTCHTNGTVYGCSCDQGYAGENCEIDIDDCLCSPCENGGTCIDEVNGF
ICLCLPSYGGSLCEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAERDCRRRAGHLTSVHS
PEEHKFINSFGHENSWIGLNDRTVERDFQWTDNTGLQYENWREKQPDNFFAGGEDCVVMV
AHESGRWNDVPCNYNLPYVCKKGTVLCGPPPAVENASLVGVRKIKYNVHATVRYQCDEGF
SQHRVATIRCRNNGKWDRPQIMCIKPRRSHRMRRHHHHPHRHHKPRKEHRKHKRHPAEDW
EKDEGDFC
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgggggccggatctgtgtgggcctcaggcctcctgctgctgtggctgcttctcctagtg
gctggggatcaggacacacaggacaccaccgccacggaaaaggggcttcgcatgctgaag
tcagggtcaggacccgtccgtgctgccctggcagagctagtggccctgccctgcttcttt
accctgcaaccacggctaagctccctgcgagacattcctcggatcaagtggactaaggtt
cagactgcatcaggccagcgacaggatttgccaatcttggtggccaaagacaacgtggtg
cgtgtggccaagggctggcagggacgggtgtcattgcctgcttatccccggcacagagcc
aatgctacccttctgctggggccacttcgagcaagcgactctgggctgtatcgctgccaa
gtggtaaagggtatcgaagatgagcaggacctggtaaccctggaagtgacaggcgtcgtg
ttccattatcgggcggcccgggaccgctatgcgctgaccttcgctgaggcccaggaggct
tgtcgcctaagctctgctaccatcgctgccccacggcacctgcaggctgcctttgaagat
ggctttgacaactgcgacgcgggctggctctcagaccgcacggttcggtacccgatcact
cagtcgcgtcctggttgctatggtgaccgcagcagtctcccgggtgttcggagctacggg
agacgcgacccgcaggaactctacgatgtctactgctttgcccgcgagctagggggtgaa
gtcttttacgtgggcccggcccgccgactgaccctggcgggcgcgcgggcacaatgtcag
cggcagggtgcagcgctggcctcggtggggcagttgcacctggcctggcacgagggcctg
gaccagtgcgacccgggctggctggcagacggcagcgtgcgctaccccatccagactccg
cgccggcgttgcgggggccccgccccaggtgtgcgcactgtgtaccgcttcgccaaccgc
accggctttcctgcgccaggagcacgcttcgacgcctactgcttccgagctcatcaccat
acagcacaacatggagattctgagatcccctcatctggagatgagggggagattgtgtca
gcagaggggcctccaggccgagaactaaagcccagcttgggggaacaggaggtgatagca
cctgacttccaggaacctctcatgtccagtggagaaggcgaacccccagacttgacttgg
acacaagcacctgaggagacccttggttctactccagggggtcccacgctggcctcatgg
ccctcttcagaaaagtggctctttacgggtgccccaagctccatgggtgtctccagtccc
agcgacatgggagtagatatggaagcgacaacacccttgggcacacaggtagcacccacc
cccacgatgaggaggggccgctttaaagggttgaatggtcgacacttccagcagcagggc
ccagaagaccagctgcctgaggtagcagagcccagtgcccagcctcccaccctgggagct
actgccaaccacatgaggccttctgcagccacagaggcttcagagagtgaccagagccac
agtccttgggccattctgaccaacgaagtggatgagccaggagcaggctctcttggcagc
aggagtctcccagagtccctgatgtggtccccgtcgttgatctcacccagtgtcccaagc
accgacagtactcctagcgcgaagccaggggcagccgaggcacccagtgtgaagtcagcc
atcccccacctgccccggctgccctcagagccccctgctccctctcccgggccctcagag
gccctaagtgctgtctccctccaggcatcctctgctgatggctcccctgacttccccatt
gtagccatgcttcgagcccccaaactgtggcttctgccacgctctacacttgtccccaat
atgaccccagtcccactgtccccagcttctccacttccctcctgggtcccagaagaacag
gctgtcaggcctgtcagccttggagcggaagacctcgaaaccccatttcagaccaccata
gctgccccagttgaagccagccacagatcccctgatgcagattctatagaaatcgagggg
accagctccatgcgggctacaaagcaccccatctctggcccatgggcttctttggactct
agtaatgtgacgatgaatcctgtcccttctgatgctggcatcctagggactgagtctggg
gtcttggacttaccagggagtcccacatcaggcggacaggccactgtggagaaggtgctg
gccacctggctaccactgcctggccaaggactagaccctggctcccagtccacacccatg
gaagcccatggggttgccgtgagcatggaacctacagtggctttggagggaggtgccacc
gagggccctatggaggccaccagggaggtggtccccagcactgctgatgccacttgggag
tctgaatccagaagtgccatttctagcacccacatagctgtgaccatggctagggctcag
ggcatgcccacactgacctctacaagctccgaaggccacccagagcctaagggccagatg
gtggcccaggagtcactggagcctctcaacactctgccttcgcacccctggtcatccctg
gtggtccccatggatgaagtggcctcagtttcctcaggggaacccacaggactgtgggac
atacccagcactctgatacctgtatccttgggcttggatgaatcagacctgaatgttgtg
gctgagagtccaagcgtgaagggcttctgggaagaggtggccagcgggcaggaagatccc
acagatccctgcgagaacaacccctgcctgcatgggggcacctgccacaccaacggcacc
gtgtatggctgtagttgtgaccagggctatgctggggagaattgtgaaattgacattgat
gactgcttatgcagcccttgcgagaatgggggcacctgcatcgacgaggtgaatggtttc
atctgcctctgcctccccagctatgggggcagcctgtgtgagaaggacacagaaggctgc
gaccgtggctggcacaaattccagggacactgctaccggtactttgcccatcgccgggcc
tgggaggatgcagagagagattgcaggcgccgagctggtcacctgacaagcgtccattcg
ccagaagagcacaagttcattaacagttttggacatgagaattcgtggatcggcctgaat
gaccggacagtagagagggacttccagtggacagacaacacaggactgcaatatgagaac
tggagggagaagcagccggataatttcttcgcaggtggggaggattgtgtggtgatggtg
gcacatgagagtgggcgctggaatgatgtcccctgcaactacaacctaccctatgtctgc
aagaagggtacagtgctgtgtggtccccctccagcagtggagaatgcctctcttgttggt
gtgcgcaagatcaagtacaatgtccatgccactgtgcgataccagtgtgatgaaggattc
tcccagcaccgagtggccactatccgctgccgtaacaatgggaagtgggaccggcctcag
atcatgtgcatcaaacccaggcggtcacatcggatgcgtagacaccaccaccatccacac
cgacatcacaagcctcgcaaggagcacagaaaacacaagagacacccagcggaagactgg
gagaaagacgaaggggatttctgctaa

DBGET integrated database retrieval system