KEGG   Mus musculus (mouse): 13007Help
Entry
13007             CDS       T01002                                 

Gene name
Csrp1, AA408841, AA959891, AW545626, CRP1, Csrp
Definition
(RefSeq) cysteine and glycine-rich protein 1
  KO
K09377  cysteine and glycine-rich protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13007 (Csrp1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain with LIM region, LIM-only transcription (co-)factors
    13007 (Csrp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM TNFR_c6 zf-ACC
Motif
Other DBs
NCBI-GeneID: 13007
NCBI-ProteinID: NP_031817
MGI: 88549
Ensembl: ENSMUSG00000026421
Vega: OTTMUSG00000021802
UniProt: P97315 Q4FJX4
Position
1; 1 E4
AA seq 193 aa AA seqDB search
MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
CYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP
RCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGF
GFGQGAGALVHSE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactggggaggaggcaagaaatgtggggtatgccagaagacggtctactttgct
gaggaggtccagtgcgagggcaacagcttccataaatcctgcttcctgtgtatggtctgc
aagaagaatctggacagcaccaccgtggcagtgcatggagaagagatctattgcaagtca
tgttacggcaagaagtatgggccaaaaggctacggctacgggcagggcgcaggcacgctg
agcacagacaagggggagtctctgggcatcaagcatgaggaagcccctggacacaggccc
accaccaaccccaatgcatccaagtttgcccagaagattggcggctctgagcgctgtccc
cgctgtagccaggcggtctatgctgcggagaaggtgatcggtgccgggaagtcctggcat
aagtcctgcttccgatgtgccaagtgtggcaaaggccttgagtcgaccaccctggcagac
aaggatggtgagatctactgtaaaggatgctatgccaaaaactttgggcccaaaggtttt
ggctttggacagggagctggagccttggttcactcagagtga

DBGET integrated database retrieval system