KEGG   Mus musculus (mouse): 13010
Entry
13010             CDS       T01002                                 

Gene name
Cst3, Cys, CysC
Definition
(RefSeq) cystatin C
  KO
K13899  cystatin-C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    13010 (Cst3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13010 (Cst3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13010 (Cst3)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I25: cystatin family
   13010 (Cst3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13010 (Cst3)
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 13010
NCBI-ProteinID: NP_034106
MGI: 102519
Ensembl: ENSMUSG00000027447
Vega: OTTMUSG00000015724
UniProt: P21460
Position
2 G3; 2 73.6 cM
AA seq 140 aa
MASPLRSLLFLLAVLAVAWAATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSND
AYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQ
IYSVPWKGTHSLTKFSCKNA
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccagcccgctgcgctccttgctgttcctgctggccgtcctggccgtggcctgggcg
gcgaccccaaaacaaggcccgcgaatgttgggagccccggaggaggcagatgccaatgag
gaaggcgtgcggcgagcgttggacttcgctgtgagcgagtacaacaagggcagcaacgat
gcgtaccacagccgcgccatacaggtggtgagagctcgtaagcagctcgtggctggagtg
aactattttttggatgtggagatgggccgaactacatgtaccaagtcccagacaaatttg
actgactgtcctttccatgaccagccccatctgatgaggaaggcactctgctccttccag
atctacagcgtgccctggaaaggcacacactccctgacaaaattcagctgcaaaaatgcc
taa

DBGET integrated database retrieval system