KEGG   Mus musculus (mouse): 13014
Entry
13014             CDS       T01002                                 

Symbol
Cstb, AA960480, Stf, Stfb
Name
(RefSeq) cystatin B
  KO
K13907  cystatin-A/B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13014 (Cstb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13014 (Cstb)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I25: cystatin family
   13014 (Cstb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13014 (Cstb)
SSDB
Motif
Pfam: Cystatin
Other DBs
NCBI-GeneID: 13014
NCBI-ProteinID: NP_031819
MGI: 109514
Ensembl: ENSMUSG00000005054
UniProt: Q62426
Position
10 C1; 10 39.72 cM
AA seq 98 aa
MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVG
GDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF
NT seq 297 nt   +upstreamnt  +downstreamnt
atgatgtgtggcgcgccatctgccacaatgccagccacggccgagacgcaggaggtcgcc
gaccaggtgaagtcccagcttgaatcgaaagaaaatcagaagtttgatgtctttaaagcc
atatccttcaagagacagatagtggctggcaccaacctcttcatcaaggttgatgttggt
ggagataaatgcgtgcacttgagggtgtttcaacccctcccccatgaaaacaagcctttg
accctgtcttcctatcagaccaacaaagaaaggcacgatgagctctcctacttctga

DBGET integrated database retrieval system