KEGG   Mus musculus (mouse): 13033
Entry
13033             CDS       T01002                                 

Gene name
Ctsd, CD, Cat, CatD
Definition
(RefSeq) cathepsin D
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04071  Sphingolipid signaling pathway
mmu04140  Autophagy - animal
mmu04142  Lysosome
mmu04210  Apoptosis
mmu04915  Estrogen signaling pathway
mmu05152  Tuberculosis
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    13033 (Ctsd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    13033 (Ctsd)
   04140 Autophagy - animal
    13033 (Ctsd)
  09143 Cell growth and death
   04210 Apoptosis
    13033 (Ctsd)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    13033 (Ctsd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    13033 (Ctsd)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    13033 (Ctsd)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13033 (Ctsd)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13033 (Ctsd)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     13033 (Ctsd)
Peptidases and inhibitors [BR:mmu01002]
 Aspartic peptidases
  Family A1: pepsin family
   13033 (Ctsd)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   13033 (Ctsd)
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Other DBs
NCBI-GeneID: 13033
NCBI-ProteinID: NP_034113
MGI: 88562
Ensembl: ENSMUSG00000007891
Vega: OTTMUSG00000060153
UniProt: P18242 Q3UCD9
Position
7; 7 F5
AA seq 410 aa
MKTPGVLLLILGLLASSSFAIIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSS
PKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEA
TKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPG
GELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLV
GPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGG
KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaagactcccggcgtcttgctgctcattctcggcctcctggcttcgtcctccttcgcg
attatcagaatccctctgcgcaagttcacatctatccgtcggactatgacggaggtgggc
ggctctgtggaagacctgatcctcaaaggccccatcaccaagtactccatgcagtcatcg
cctaagaccacggagccagtgtcagagttactcaaaaactacctggatgcccagtactat
ggcgatatcggcatcggaaccccgccgcagtgtttcacagtcgtctttgatactggctcc
tctaacctgtgggtcccctccattcattgcaagatacttgacatagcctgctgggtccac
cataagtacaacagtgacaagtccagcacctatgtgaagaacggcacgtcctttgacatc
cactacggctcaggaagcctctctgggtacctgagccaggacactgtatcggttccatgt
aagtctgaccagtcaaaggcaagaggtatcaaggtggagaaacagatctttggagaagcc
accaagcagcctggaatcgtatttgttgcagccaagtttgatggcatcttgggcatgggc
taccctcatatctctgttaacaacgtgcttccggtctttgacaacctgatgcaacagaag
ctggtggacaagaacatcttctccttctacctgaacagggacccagaagggcaacccgga
ggagaactaatgcttggtggcactgactccaagtactaccacggggagctgtcctacctg
aacgtcactcgaaaggcctactggcaggtgcacatggaccagttggaggtgggcaatgag
ctgaccctgtgcaagggaggctgtgaggctattgtggacacagggacatctcttctggtg
gggcctgtggaagaggtgaaggagctgcagaaggccatcggggcagtgcctcttatccag
ggtgagtatatgattccttgtgagaaggtgtccagcctgcccacggtctacctgaagcta
ggaggcaaaaactatgaactacacccagacaagtatatactcaaggtatcgcagggtgga
aagacaatctgcctgagtggcttcatgggaatggacataccccctcccagtgggccgctc
tggatcctgggcgatgtcttcattggttcctactacactgtgtttgacagagacaacaat
agggtcggctttgccaatgctgtcgtactctaa

DBGET integrated database retrieval system