KEGG   Mus musculus (mouse): 13035
Entry
13035             CDS       T01002                                 

Gene name
Ctsg, CatG, VSP
Definition
(RefSeq) cathepsin G
  KO
K01319  cathepsin G [EC:3.4.21.20]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04142  Lysosome
mmu04613  Neutrophil extracellular trap formation
mmu04614  Renin-angiotensin system
mmu05146  Amoebiasis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13035 (Ctsg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    13035 (Ctsg)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    13035 (Ctsg)
  09152 Endocrine system
   04614 Renin-angiotensin system
    13035 (Ctsg)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    13035 (Ctsg)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    13035 (Ctsg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13035 (Ctsg)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13035 (Ctsg)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     13035 (Ctsg)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   13035 (Ctsg)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Others
   13035 (Ctsg)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 13035
NCBI-ProteinID: NP_031826
MGI: 88563
Ensembl: ENSMUSG00000040314
UniProt: P28293 Q059V7
Position
14 C3; 14 28.19 cM
AA seq 261 aa
MQPLLLLLTFILLQGDEAGKIIGGREARPHSYPYMAFLLIQSPEGLSACGGFLVREDFVL
TAAHCLGSSINVTLGAHNIQMRERTQQLITVLRAIRHPDYNPQNIRNDIMLLQLRRRARR
SGSVKPVALPQASKKLQPGDLCTVAGWGRVSQSRGTNVLQEVQLRVQMDQMCANRFQFYN
SQTQICVGNPRERKSAFRGDSGGPLVCSNVAQGIVSYGSNNGNPPAVFTKIQSFMPWIKR
TMRRFAPRYQRPANSLSQAQT
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcagcctctcctgctcctgttgacctttattctactccaaggagatgaggcagggaag
atcattggaggccgagaagccaggccccattcctacccctacatggcatttcttctgatc
cagagtccagaagggctgagtgcttgtggagggtttctggtgcgagaagacttcgtccta
acagcagctcattgcttgggaagctccataaatgttactctaggggcccacaacatccaa
atgcgagaaaggacccagcaactcatcacagtgctcagagccatccgccatcctgattac
aatccgcagaacatccggaatgacatcatgcttctgcagctgaggcgcagagcccggagg
agtggatcggtgaagcctgtggctctgcctcaggccagcaaaaaactgcagccaggggat
ttgtgcacagtggctggctggggccgggtaagccagagcaggggaacaaatgtactccag
gaggtgcagctaagagtgcagatggaccaaatgtgcgccaatcgcttccagttctacaac
agccagactcagatctgtgtgggaaacccgagagaaaggaagtctgccttcaggggtgat
tctggtggccccctggtatgtagcaatgtggcccagggcatcgtctcctatggaagcaac
aatggtaaccctccagctgtattcaccaaaatccagagcttcatgccctggatcaaaaga
acaatgagacgctttgcaccaagatatcagagacctgctaactccctgtctcaggcacag
acctag

DBGET integrated database retrieval system