KEGG   Mus musculus (mouse): 13035
Entry
13035             CDS       T01002                                 

Gene name
Ctsg, CatG, VSP
Definition
(RefSeq) cathepsin G
  KO
K01319  cathepsin G [EC:3.4.21.20]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04142  Lysosome
mmu04614  Renin-angiotensin system
mmu05146  Amoebiasis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13035 (Ctsg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    13035 (Ctsg)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    13035 (Ctsg)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    13035 (Ctsg)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    13035 (Ctsg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13035 (Ctsg)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13035 (Ctsg)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     13035 (Ctsg)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   13035 (Ctsg)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Others
   13035 (Ctsg)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 13035
NCBI-ProteinID: NP_031826
MGI: 88563
Ensembl: ENSMUSG00000040314
UniProt: P28293 Q059V7
Position
14 C3; 14 28.19 cM
AA seq 261 aa
MQPLLLLLTFILLQGDEAGKIIGGREARPHSYPYMAFLLIQSPEGLSACGGFLVREDFVL
TAAHCLGSSINVTLGAHNIQMRERTQQLITVLRAIRHPDYNPQNIRNDIMLLQLRRRARR
SGSVKPVALPQASKKLQPGDLCTVAGWGRVSQSRGTNVLQEVQLRVQMDQMCANRFQFYN
SQTQICVGNPRERKSAFRGDSGGPLVCSNVAQGIVSYGSNNGNPPAVFTKIQSFMPWIKR
TMRRFAPRYQRPANSLSQAQT
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcagcctctcctgctcctgttgacctttattctactccaaggagatgaggcagggaag
atcattggaggccgagaagccaggccccattcctacccctacatggcatttcttctgatc
cagagtccagaagggctgagtgcttgtggagggtttctggtgcgagaagacttcgtccta
acagcagctcattgcttgggaagctccataaatgttactctaggggcccacaacatccaa
atgcgagaaaggacccagcaactcatcacagtgctcagagccatccgccatcctgattac
aatccgcagaacatccggaatgacatcatgcttctgcagctgaggcgcagagcccggagg
agtggatcggtgaagcctgtggctctgcctcaggccagcaaaaaactgcagccaggggat
ttgtgcacagtggctggctggggccgggtaagccagagcaggggaacaaatgtactccag
gaggtgcagctaagagtgcagatggaccaaatgtgcgccaatcgcttccagttctacaac
agccagactcagatctgtgtgggaaacccgagagaaaggaagtctgccttcaggggtgat
tctggtggccccctggtatgtagcaatgtggcccagggcatcgtctcctatggaagcaac
aatggtaaccctccagctgtattcaccaaaatccagagcttcatgccctggatcaaaaga
acaatgagacgctttgcaccaagatatcagagacctgctaactccctgtctcaggcacag
acctag

DBGET integrated database retrieval system