KEGG   Mus musculus (mouse): 13038
Entry
13038             CDS       T01002                                 

Gene name
Ctsk, AI323530, MMS10-Q, Ms10q, catK
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04210  Apoptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    13038 (Ctsk)
  09143 Cell growth and death
   04210 Apoptosis
    13038 (Ctsk)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    13038 (Ctsk)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    13038 (Ctsk)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    13038 (Ctsk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    13038 (Ctsk)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    13038 (Ctsk)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     13038 (Ctsk)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C1: papain family
   13038 (Ctsk)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Papain family
   13038 (Ctsk)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 13038
NCBI-ProteinID: NP_031828
MGI: 107823
Ensembl: ENSMUSG00000028111
Vega: OTTMUSG00000053004
UniProt: P55097 Q545T0
Structure
PDB: 
5T6U 6BKI

Position
3 F2.1; 3 40.74 cM
AA seq 329 aa
MWVFKFLLLPMVSFALSPEEMLDTQWELWKKTHQKQYNSKVDEISRRLIWEKNLKQISAH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLRIPPSRSYSNDTLYTPEWEGRVPDSID
YRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGG
YMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVA
RVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGE
SWGNKGYALLARNKNNACGITNMASFPKM
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtgggtgttcaagtttctgctgctacccatggtgagctttgctctgtctccggaggaa
atgctggacacccagtgggagctatggaagaagactcaccagaagcagtataacagcaag
gtggatgaaatctctcggcgtttaatttgggagaaaaacctgaagcaaatctctgcccat
aacctggaggcctctcttggtgtccatacatatgaactggccatgaaccacttgggagac
atgaccagtgaagaagtggttcagaagatgacgggactcagaatacctccctctcgatcc
tacagtaatgacactctctataccccagagtgggaaggcagggtcccagactccatcgac
tatcgaaagaaaggatacgttactccagtcaagaaccagggccagtgtggttcctgttgg
gctttcagctctgccggggccctggagggccaactcaagaagaaaactggtaaactctta
gctctgagtccccagaatcttgtggactgtgtgactgagaattatggctgtggaggcggc
tatatgaccactgccttccaatacgtgcagcagaacggaggcattgactctgaagatgct
tacccatatgtgggccaggatgaaagttgtatgtataacgccacggcaaaggcagctaaa
tgcagagggtacagagagattcctgtggggaacgagaaagccctgaagagagcagtggcg
cgggtaggacccatctctgtgtccatcgatgcaagcttggcatctttccagttttacagc
agaggtgtgtactatgatgaaaattgtgaccgtgataatgtgaaccatgcagtgttggtg
gtgggctatggcacccagaagggaagcaagcactggataattaaaaacagctggggagag
agctggggaaacaaaggatatgctctcttggctcggaataagaacaacgcctgcggcatt
accaacatggccagcttccccaagatgtga

DBGET integrated database retrieval system