KEGG   Mus musculus (mouse): 13039Help
Entry
13039             CDS       T01002                                 

Gene name
Ctsl, 1190035F06Rik, CatL, Ctsl1, MEP, fs, nkt
Definition
(RefSeq) cathepsin L
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu04142  Lysosome
mmu04145  Phagosome
mmu04210  Apoptosis
mmu04612  Antigen processing and presentation
mmu05205  Proteoglycans in cancer
mmu05323  Rheumatoid arthritis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    13039 (Ctsl)
   04142 Lysosome
    13039 (Ctsl)
   04140 Autophagy - animal
    13039 (Ctsl)
  09143 Cell growth and death
   04210 Apoptosis
    13039 (Ctsl)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    13039 (Ctsl)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    13039 (Ctsl)
  09163 Immune disease
   05323 Rheumatoid arthritis
    13039 (Ctsl)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    13039 (Ctsl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    13039 (Ctsl)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    13039 (Ctsl)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    13039 (Ctsl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     13039 (Ctsl)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   13039 (Ctsl)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Papain family
   13039 (Ctsl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  13039 (Ctsl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 13039
NCBI-ProteinID: NP_034114
MGI: 88564
Ensembl: ENSMUSG00000021477
UniProt: P06797 Q543M3
Position
13 B3; 13 33.26 cM
AA seq 334 aa AA seqDB search
MNLLLLLAVLCLGTALATPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQ
LHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDW
REKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNG
GLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVA
TVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKN
SWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttttactccttttggctgtcctctgcttgggaacagccttagctactccaaaa
tttgatcaaacctttagtgcagagtggcaccagtggaagtccacacacagaagactgtat
ggcacgaatgaggaagagtggaggagagcgatatgggagaagaacatgagaatgatccag
ctacacaacggggaatacagcaacgggcagcacggcttttccatggagatgaacgccttc
ggtgacatgaccaatgaggaattcaggcaggtggtgaatggctaccgccaccagaagcac
aagaaggggaggctttttcaggaaccgctgatgcttaagatccccaagtctgtggactgg
agagaaaagggttgtgtgactcctgtgaagaaccagggccagtgcgggtcttgttgggcg
tttagcgcatcgggttgcctagaaggacagatgttccttaagaccggcaaactgatctca
ctgagtgaacagaaccttgtggactgttctcacgctcaaggcaatcagggctgtaacgga
ggcctgatggattttgctttccagtacattaaggaaaatggaggtctggactcggaggag
tcttacccctatgaagcgaaggacggatcttgtaaatacagagccgagttcgctgtggct
aatgacacagggttcgtggatatccctcagcaagagaaagccctcatgaaggctgtggcg
actgtggggcctatttctgttgctatggacgcaagccatccgtctctccagttctatagt
tcaggcatctactatgaacccaactgtagcagcaagaacctcgaccatggggttctgttg
gtgggctatggctatgaaggaacagattcaaataagaataaatattggcttgtcaagaac
agctggggaagtgaatggggtatggaaggctacatcaaaatagccaaagaccgggacaac
cactgtggacttgccaccgcggccagctatcctgtcgtgaattga

DBGET integrated database retrieval system