KEGG   Mus musculus (mouse): 13043
Entry
13043             CDS       T01002                                 

Gene name
Cttn, 1110020L01Rik, Ems, Ems1
Definition
(RefSeq) cortactin
  KO
K06106  cortactin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
mmu05100  Bacterial invasion of epithelial cells
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    13043 (Cttn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    13043 (Cttn)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    13043 (Cttn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13043 (Cttn)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    13043 (Cttn)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    13043 (Cttn)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    13043 (Cttn)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     13043 (Cttn)
SSDB
Motif
Pfam: HS1_rep SH3_9 SH3_1 SH3_2 TAF4
Other DBs
NCBI-GeneID: 13043
NCBI-ProteinID: NP_031829
MGI: 99695
Ensembl: ENSMUSG00000031078
Vega: OTTMUSG00000016455
UniProt: Q60598
Structure
PDB: 
5NVJ 5NV1 3ULR 5NXJ

Position
7; 7 F5
AA seq 546 aa
MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQ
DYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFENLAKE
REQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKKQTPPASPSPQPIEDRPPSSPI
YEDAAPFKAEPSYRGSEPEPEYSIEAAGIPEAGSQQGLTYTSEPVYETTEAPGHYQAEDD
TYDGYESDLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPAN
YVELRQ
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgtggaaagcctctgcaggccatgctgtgtccatcacgcaggatgatggaggagctgat
gactgggagactgatcctgattttgtgaatgatgtgagtgaaaaggagcagagatggggt
gctaaaaccgtgcagggatcggggcaccaggaacacatcaacattcacaagcttcgagag
aatgtcttccaagaacaccagacgctcaaggagaaggagctggaaacgggacccaaggct
tcccacggctatggcgggaagttcggtgtggagcaggataggatggacagatcagccgtg
ggccatgagtaccagtcgaagctttccaagcactgctcacaagtggactcggtccggggc
ttcggaggcaagttcggtgtccagatggacagggtggatcagtctgctgtaggctttgaa
taccaggggaagactgagaagcatgcctcccagaaagactactctagtggcttcggtggc
aaatacggtgtgcaagctgaccgtgtagacaagagtgccgtgggctttgactaccagggc
aagacggagaagcatgagtctcagaaagattactccaaaggttttggtggcaaatatggg
attgacaaggacaaggtggataaaagtgctgtgggctttgagtatcaaggcaagacagag
aagcacgaatcccagaaagactatgtaaaaggctttggaggaaagtttggtgtgcagaca
gacagacaggacaagtgtgcccttggctgggaccatcaggagaagctgcagctgcatgaa
tcccaaaaagactataagactggtttcggaggcaaatttggtgttcagtccgagaggcag
gactcctccgctgtggggtttgattacaaggagagattggccaagcacgagtcccagcaa
gactatgccaaaggattcggcgggaagtatggggtgcagaaggatcggatggacaagaat
gcatccacctttgaagaagtggtccaggtgccatctgcctatcagaagactgtccccatt
gaggccgtaaccagcaaaaccagtaatatccgtgctaactttgaaaacctggcaaaggag
agagagcaggaggacaggcggaaggcagaagccgagagagctcagcggatggccaaagaa
agacaggagcaggaggaggcgcgcaggaagctggaagagcaagccagagccaagaagcag
acgccccctgcatcccctagtcctcaaccaattgaagacagaccaccctccagccccatc
tatgaggatgcagctccgttcaaggccgagccgagctaccgaggtagcgaacctgagcct
gagtacagcatcgaggccgcaggcattcctgaggctggcagccagcaaggcctgacctat
acatcagagcccgtgtacgagactacagaggctcctggccactatcaagcagaggatgac
acctacgatgggtatgagagtgacctgggcatcacagccatcgccctgtatgactaccag
gctgctggcgatgatgagatctcctttgaccctgatgacatcatcaccaacatagaaatg
attgacgatggctggtggcgtggggtgtgcaagggcagatacgggctcttcccagccaac
tatgtggagctgcggcagtag

DBGET integrated database retrieval system