KEGG   Mus musculus (mouse): 13046Help
Entry
13046             CDS       T01002                                 

Gene name
Celf1, 1600010O03Rik, AA407467, Brunol2, CUG-BP, CUG-BP1, CUGBP, Cugbp1, D2Wsu101e, HNAB50, NAB50
Definition
(RefSeq) CUGBP, Elav-like family member 1
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    13046 (Celf1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    13046 (Celf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RNA_bind RRM_7 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 13046
NCBI-ProteinID: NP_001231820
MGI: 1342295
Ensembl: ENSMUSG00000005506
Vega: OTTMUSG00000014337
UniProt: P28659
Position
2 E1; 2 50.44 cM
AA seq 486 aa AA seqDB search
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINILRDRSQNPPQSKG
CCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
ENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRTMAQTAIKAMHQAQTMEGCSSP
MVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTAS
SGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSGSS
PSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALT
QAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQM
FMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSK
NDSKPY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaccctggaccacccagaccaaccagatcttgatgctatcaagatgtttgtg
ggccaggttccaaggacctggtctgagaaagacttgagggagctttttgagcagtatggt
gctgtctatgaaatcaacatcctaagggataggagccaaaaccctcctcagagcaaaggg
tgctgttttgttacattttacacccgtaaagctgcattagaagctcagaatgctctccat
aacatgaaggtcctccctgggatgcatcaccctatacagatgaagcctgctgacagtgaa
aagaacaatgctgtggaagacaggaagctctttattggtatgatttccaagaagtgtact
gaaaatgacatccgagtcatgttttcttcgtttggacagattgaagagtgccggatattg
cggggacctgatggcttgagcagaggttgtgcatttgtgacttttactacaagaaccatg
gcacagacagctatcaaagcaatgcaccaagcacaaaccatggagggttgctcatcccca
atggtggtaaagtttgccgacacccagaaggacaaagaacagaagagaatggcccagcag
ctccagcagcagatgcagcagatcagtgcagcgtctgtgtggggaaacctggctggtctg
aacacacttggaccccagtacttagcactttatttgcagctcctacagcagactgcctcc
tctgggaacctcaacaccctgagcagcctccacccaatgggagggttaaatgcaatgcag
ctacagaatttggctgcactagctgctgcagctagtgcagctcagaacacaccaagtggt
accaatgctctcactacatccagcagtcccctcagcgtactcaccagttcagggtcttca
ccgagctccagcagcagtaattctgtcaaccccatagcctcacttggagccctgcaaaca
ttggccggagcaacagctggcctcaacgttggctcattggcagggatggctgctttgaat
ggtggtctgggcagcagtggcctttccaatggcactgggagtaccatggaagccctcacc
caggcgtattctggtatccagcaatatgctgctgcagccctccccactctgtacaaccag
aatttattgacacagcagagtattggtgctgctggaagccagaaggaaggtccagaagga
gccaacctgttcatctatcacctgccccaggagtttggagaccaggacttactgcagatg
tttatgccctttgggaatgtcgtgtcggccaaggttttcatagacaagcagacaaacctg
agcaagtgctttggttttgtaagttatgacaatcctgtctcagctcaagctgccatccag
tccatgaacggctttcaaattggaatgaagaggcttaaagtgcagctcaaacgttcgaag
aatgatagtaagccctactga

DBGET integrated database retrieval system