KEGG   Mus musculus (mouse): 13052
Entry
13052             CDS       T01002                                 

Symbol
Cxadr, 2610206D03Rik, AU016810, AW553441, CAR, MCAR, MCVADR
Name
(RefSeq) coxsackie virus and adenovirus receptor
  KO
K06788  coxsackievirus and adenovirus receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    13052 (Cxadr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    13052 (Cxadr)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  CTX family
   13052 (Cxadr)
SSDB
Motif
Pfam: V-set I-set ig Ig_3 Ig_2 Herpes_gE EphA2_TM Insulin_TMD
Other DBs
NCBI-GeneID: 13052
NCBI-ProteinID: NP_001020363
MGI: 1201679
Ensembl: ENSMUSG00000022865
Vega: OTTMUSG00000014961
UniProt: P97792
Structure
PDB: 
3JZ7 3MJ7

Position
16; 16 C3.1
AA seq 365 aa
MARLLCFVLLCGIADFTSGLSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS
PSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQC
KVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSD
SQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAGTIA
GAVIGTLLALVLIGAILFCCHRKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
SLGSMSPSNMEGYSKTQYNQVPSEDFERAPQSPTLAPAKVAAPNLSRMGAVPVMIPAQSK
DGSIV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgcgcctactgtgcttcgtgctcttgtgcgggatcgcggatttcaccagtggtttg
agcatcactacacccgaacagaggatcgaaaaagccaaaggggaaactgcgtatctacca
tgcaagtttactctcagtcccgaagaccagggaccactggacattgaatggctgatatcc
ccgtctgataaccagatagtggatcaagtgatcattttgtattctggagacaaaatttat
gataactactatccggatctgaaaggacgggtacattttacgagtaacgatgtcaagtct
ggcgacgcatctataaatgtgaccaacctgcagctgtcggacattggcacttaccagtgc
aaagtgaagaaagcccctggggttgcaaataagaaattcctgctgaccgttcttgttaag
ccttcaggtacaagatgcttcgtggatggatcggaagagattggaaatgacttcaagcta
aaatgtgaacccaaggaaggctcccttccactacagtttgaatggcagaaactgtcggac
tcccagacaatgcctacgccatggctggcagaaatgacgtcaccagttatatctgtgaag
aacgccagttctgagtattctgggacatacagctgcacggttcaaaacagagtgggctct
gaccagtgtatgctgcgactagacgttgtcccaccctccaaccgagccggaacgatcgcg
ggcgccgtcatagggacgctgctggcccttgtgctcatcggggccatcctcttctgctgt
cacaggaaacgcagagaagagaagtacgagaaggaagttcatcatgatatcagggaagat
gtgcctcctccaaagagtcggacatccactgccaggagctatattggcagcaaccattcc
tccctgggatccatgtccccctctaacatggaggggtattccaagacgcagtataaccaa
gtccccagtgaagactttgaacgtgcgcctcagagcccgactctggcacccgctaaggta
gctgcccctaatctcagtcgaatgggagcggttcctgtgatgattcctgcacagagcaag
gacgggtctatagtatag

DBGET integrated database retrieval system