KEGG   Mus musculus (mouse): 13057
Entry
13057             CDS       T01002                                 

Gene name
Cyba, b558, nmf333, p22-phox, p22phox
Definition
(RefSeq) cytochrome b-245, alpha polypeptide
  KO
K08009  cytochrome b-245, alpha polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04621  NOD-like receptor signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05415  Diabetic cardiomyopathy
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    13057 (Cyba)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    13057 (Cyba)
   04621 NOD-like receptor signaling pathway
    13057 (Cyba)
   04670 Leukocyte transendothelial migration
    13057 (Cyba)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    13057 (Cyba)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    13057 (Cyba)
  09164 Neurodegenerative disease
   05020 Prion disease
    13057 (Cyba)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    13057 (Cyba)
   05415 Diabetic cardiomyopathy
    13057 (Cyba)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13057 (Cyba)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    13057 (Cyba)
SSDB
Motif
Pfam: Cytochrom_B558a Cg6151-P
Other DBs
NCBI-GeneID: 13057
NCBI-ProteinID: NP_031832
MGI: 1316658
Ensembl: ENSMUSG00000006519
Vega: OTTMUSG00000061846
UniProt: Q61462 B3VQI8
Position
8; 8 E1
AA seq 192 aa
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRK
KGSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVI
YLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGP
QVNPMPVTDEVV
NT seq 579 nt   +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgaacaggcgctggcgtctggcctgatt
ctcatcactgggggcatcgtggctactgctggacgtttcacacagtggtatttcggcgcc
tactctatcgctgcaggtgtgctcatctgtctgctggagtatccccggggaaagaggaaa
aaggggtccaccatggagcgatgtggacagaagtacctgacctctgtggtgaagcttttc
gggcccctcaccaggaattactacgtccgggctgccctccacttcctgttgtcggtgcct
gcaggcttcctcctggccaccatcctggggaccgtctgcttggccattgccagtgtgatc
tatctgctggcagccatccgaggtgagcagtggactcccattgagcctaaacccaaggag
cggccacaggttggaggcaccatcaagcaaccacctaccaaccccccaccccggccaccc
gcagaggtccgaaagaagccgagtgagggtgaagaggaggcagcctcagctggaggaccc
caggttaacccaatgccagtgacagatgaggtcgtgtga

DBGET integrated database retrieval system