KEGG   Mus musculus (mouse): 13057
Entry
13057             CDS       T01002                                 

Gene name
Cyba, b558, nmf333, p22-phox, p22phox
Definition
(RefSeq) cytochrome b-245, alpha polypeptide
  KO
K08009  cytochrome b-245, alpha polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04621  NOD-like receptor signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    13057 (Cyba)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    13057 (Cyba)
   04621 NOD-like receptor signaling pathway
    13057 (Cyba)
   04670 Leukocyte transendothelial migration
    13057 (Cyba)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    13057 (Cyba)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    13057 (Cyba)
  09164 Neurodegenerative disease
   05020 Prion disease
    13057 (Cyba)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    13057 (Cyba)
   05418 Fluid shear stress and atherosclerosis
    13057 (Cyba)
   05415 Diabetic cardiomyopathy
    13057 (Cyba)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13057 (Cyba)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    13057 (Cyba)
SSDB
Motif
Pfam: Cytochrom_B558a Cg6151-P DUF6030
Other DBs
NCBI-GeneID: 13057
NCBI-ProteinID: NP_031832
MGI: 1316658
Ensembl: ENSMUSG00000006519
Vega: OTTMUSG00000061846
UniProt: Q61462 B3VQI8
Position
8; 8 E1
AA seq 192 aa
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIAAGVLICLLEYPRGKRK
KGSTMERCGQKYLTSVVKLFGPLTRNYYVRAALHFLLSVPAGFLLATILGTVCLAIASVI
YLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEGEEEAASAGGP
QVNPMPVTDEVV
NT seq 579 nt   +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgaacaggcgctggcgtctggcctgatt
ctcatcactgggggcatcgtggctactgctggacgtttcacacagtggtatttcggcgcc
tactctatcgctgcaggtgtgctcatctgtctgctggagtatccccggggaaagaggaaa
aaggggtccaccatggagcgatgtggacagaagtacctgacctctgtggtgaagcttttc
gggcccctcaccaggaattactacgtccgggctgccctccacttcctgttgtcggtgcct
gcaggcttcctcctggccaccatcctggggaccgtctgcttggccattgccagtgtgatc
tatctgctggcagccatccgaggtgagcagtggactcccattgagcctaaacccaaggag
cggccacaggttggaggcaccatcaagcaaccacctaccaaccccccaccccggccaccc
gcagaggtccgaaagaagccgagtgagggtgaagaggaggcagcctcagctggaggaccc
caggttaacccaatgccagtgacagatgaggtcgtgtga

KEGG   Mus musculus (mouse): 17969
Entry
17969             CDS       T01002                                 

Gene name
Ncf1, NCF-47K, NO, NOXO2, Ncf-, Ncf-1, p47-phox, p47<ph, p47<phox>, p47p, p47phox
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17969 (Ncf1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    17969 (Ncf1)
   04666 Fc gamma R-mediated phagocytosis
    17969 (Ncf1)
   04670 Leukocyte transendothelial migration
    17969 (Ncf1)
   04062 Chemokine signaling pathway
    17969 (Ncf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    17969 (Ncf1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    17969 (Ncf1)
  09164 Neurodegenerative disease
   05020 Prion disease
    17969 (Ncf1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    17969 (Ncf1)
   05418 Fluid shear stress and atherosclerosis
    17969 (Ncf1)
   05415 Diabetic cardiomyopathy
    17969 (Ncf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17969 (Ncf1)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    17969 (Ncf1)
SSDB
Motif
Pfam: SH3_1 NECFESHC SH3_9 p47_phox_C PX SH3_2 hSH3 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 17969
NCBI-ProteinID: NP_035006
MGI: 97283
Ensembl: ENSMUSG00000015950
Vega: OTTMUSG00000020372
UniProt: Q09014 Q3UBI5
Position
5 G2; 5 74.47 cM
AA seq 390 aa
MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPI
EAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKV
RPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATG
DVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAV
EEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAP
PRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKDNPSTPRVK
PQPAVPPRPSSDLILHRCTESTKRKLTSAV
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgggggacaccttcattcgccatattgccctgctgggcttcgagaagcgcttcatcccc
agccagcactatgtgtacatgttcctggttaagtggcaggacctgtcggagaaggtggtc
tacagaaaattcaccgagatctacgagttccataaaatgctgaaggagatgttccccatt
gaggccggcgagatccacacagagaacagagtcatcccacacctcccggcacccaggtgg
tttgatgggcaacgagccgctgagagtcgccagggcactctcactgaatacttcaacggc
ctcatgggactgcccgtgaagatctcccgctgcccacacctgctggacttcttcaaagtg
cggcctgatgacctgaaactgcccactgacagccaggcgaagaagcctgagacatacctg
gtgcccaaagatggcaagaataacgtagctgacatcacaggccccatcatccttcagacc
tatcgggccattgctgactacgagaagagttcgggaacagagatgaccgtggcaaccgga
gacgtggtggacgttgtggagaagagcgagagcggctggtggttttgccagatgaagaca
aagcgaggttgggtccctgcatcctatctggagccccttgacagtcccgacgaggcggag
gatccggatcccaactacgcaggtgaaccgtatgtaaccatcaaagcgtacgctgctgtt
gaagaggacgagatgtccctgtctgagggtgaagccattgaggtcattcataagctcctg
gatggctggtgggtggtcaggaaaggggatatcaccggctatttcccatccatgtatctg
cagaaggctggggaggagataacccaggcccagcgacagatcagaggccgcggggcacca
cctcgaaggtcgaccatccgcaacgcacagagcatccaccagcgttctcggaagcgcctt
agccaggacacctatcgccgcaacagcgtccgattcctgcagcagcgcagacgcccgggg
cgacccgggccgctgagcacggatggcacaaaggacaatccatcgactccgcgcgtcaaa
ccacagcccgcggtgcctccgcgacccagctcggacctcatcctgcaccgctgcacagag
agcaccaaacggaagctgacgtccgctgtgtga

KEGG   Mus musculus (mouse): 17970
Entry
17970             CDS       T01002                                 

Gene name
Ncf2, NO, NOXA2, Ncf-, Ncf-2, p67p, p67phox
Definition
(RefSeq) neutrophil cytosolic factor 2
  KO
K08010  neutrophil cytosolic factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17970 (Ncf2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    17970 (Ncf2)
   04670 Leukocyte transendothelial migration
    17970 (Ncf2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    17970 (Ncf2)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    17970 (Ncf2)
  09164 Neurodegenerative disease
   05020 Prion disease
    17970 (Ncf2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    17970 (Ncf2)
   05418 Fluid shear stress and atherosclerosis
    17970 (Ncf2)
   05415 Diabetic cardiomyopathy
    17970 (Ncf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17970 (Ncf2)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    17970 (Ncf2)
SSDB
Motif
Pfam: SH3_1 SH3_2 SH3_9 TPR_1 TPR_2 PB1 TPR_8 TPR_12 SusD-like_3 TPR_17 TPR_9 TPR_6
Other DBs
NCBI-GeneID: 17970
NCBI-ProteinID: NP_035007
MGI: 97284
Ensembl: ENSMUSG00000026480
Vega: OTTMUSG00000049696
UniProt: O70145
Position
1 G3; 1 65.05 cM
AA seq 525 aa
MSLAEAIRLWNEGVLAADKKDWKGALEAFSEVQDPHSRICFNIGCVNTILENLQAAEQAF
TKSINRDKHSAVAYFQRGMLYYRMEKYDLAIKDLKEALTQLRGNQLIDYKILGLQFKLFA
CEVLYNIALMHAKKEEWKKAEEQLALATNMKSEPRHSKIDKAMESIWKQKLFEPVVIPVG
RLFRPNERQVAQLAKKDYLGKATVVASVVHQDNFSGFAPLQPQSAEPPPRPKTPEIFRAL
EGEAHRVLFGFVPETPEELQVMPGNIVFVLKKGSDNWATVMFNGQKGLVPCNYLEPVELR
IHPQSQPQEDTSPESDIPPPPNSSPPGRLQLSPGHKQKEPKELKLSVPMPYMLKVHYKYT
VVMETRLGLPYSQLRNMVSKKLALSPEHTKLSYRRRDSHELLLLSEESMKDAWGQVKNYC
LTLWCEHTVGDQGLIDEPIQRENSDASKQTTEPQPKEGTQVVAIFSYEAAQPEDLEFVEG
DVILVLSHVNEEWLEGECKGKVGIFPKAFVEGCAAKNLEGIPREV
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccctggctgaggccatcagactctggaatgaaggggtgctcgcagccgacaagaag
gactggaagggtgccctggaggccttcagcgaggtgcaggacccccactcgaggatttgc
ttcaacataggctgcgtgaacactatcctggaaaacttgcaggcagccgagcaggccttc
accaaaagcatcaacagagacaagcactctgcagtggcctacttccagagaggaatgctc
tactacagaatggagaagtacgaccttgctatcaaagaccttaaagaggccttgacgcag
cttcgtgggaaccagctgatagactacaagatcctggggctgcagttcaagctgtttgcc
tgtgaggtattgtacaatattgctctcatgcatgccaagaaagaggaatggaagaaagca
gaagagcagttggcattggcaaccaacatgaagtccgagcccaggcattccaagatcgac
aaggccatggagagcatctggaagcagaagctgttcgagcccgtggtgatccctgtgggt
cggctgttccgtccaaatgagaggcaggtggctcagctggccaaaaaggactatctgggc
aaggctacggttgtagcatctgtggttcaccaagacaacttttctggcttcgcccctctg
cagccacagtcagcagagcctcctcccagacccaaaaccccagaaatcttcagggctctg
gaaggtgaggcacaccgcgtattgtttggctttgtgccggagacgccagaagagctacag
gtcatgcctgggaacatcgtctttgtcttgaagaagggcagtgataactgggccacagtc
atgttcaatggacagaaggggcttgtcccctgcaactacctggagccagttgagcttcgg
attcaccctcagtcgcagccccaggaagatacctctccagaatccgatattccaccacct
cctaattctagccccccaggaagactccagttgtcaccaggtcacaagcaaaaagagccc
aaggaactgaagctcagcgtgcctatgccttacatgctcaaggtgcattacaaatacaca
gtggtcatggagacgcggcttggcctcccctacagccagcttcggaacatggtgtctaag
aagctggcgctctcgccagaacacactaaactgagctaccggcgtcgggacagccacgag
cttctgctcctgtccgaagaaagcatgaaggatgcctggggccaagtgaaaaactactgc
ctgactctgtggtgtgagcatacggtgggtgaccaaggtcttattgatgaacccatacaa
agggaaaactcagacgccagtaagcagactacggagcctcagcctaaggaggggacccag
gtggtagcaatcttcagttatgaggctgcccagccagaagacctggaatttgtggaagga
gatgtaatcctggtactgtcacatgtgaatgaagaatggctggaaggggagtgtaaaggg
aaagttggcattttcccgaaggcttttgttgaaggatgtgcagccaagaatttggaaggc
attcccagagaagtctag

KEGG   Mus musculus (mouse): 17972
Entry
17972             CDS       T01002                                 

Gene name
Ncf4, AI451400, p40p, p40phox
Definition
(RefSeq) neutrophil cytosolic factor 4
  KO
K08012  neutrophil cytosolic factor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04613  Neutrophil extracellular trap formation
mmu04670  Leukocyte transendothelial migration
mmu05020  Prion disease
mmu05140  Leishmaniasis
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17972 (Ncf4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    17972 (Ncf4)
   04670 Leukocyte transendothelial migration
    17972 (Ncf4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    17972 (Ncf4)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    17972 (Ncf4)
  09164 Neurodegenerative disease
   05020 Prion disease
    17972 (Ncf4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    17972 (Ncf4)
   05415 Diabetic cardiomyopathy
    17972 (Ncf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17972 (Ncf4)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    17972 (Ncf4)
SSDB
Motif
Pfam: PB1 PX SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 17972
NCBI-ProteinID: NP_032703
MGI: 109186
Ensembl: ENSMUSG00000071715
Vega: OTTMUSG00000028142
UniProt: P97369
Position
15 E1; 15 37.1 cM
AA seq 339 aa
MALAQQLRSESDFEQLPDDVAVSANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGAKQEIAETRIPALNAYMKNLLSLP
VCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGVSPQGAIMDRMEAPRAEALFD
FTGNSKLELSFKAGDVIFLLSKINKDWLEGTSQGATGIFPGSFVKILKDFPEDEDTTNWL
RCYFYEDTGKTIKDIAVEEDLSSTPLFKDLLALMRREFQREDIALSYQDAEGDLVRLLSD
EDVGLMVKQARGLPSQKRLFPWKLHVTQKDNYSVYNTVP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggccctggcccagcagctgcgatcagagagcgactttgagcagcttccagacgatgtg
gccgtctcagccaacatcgctgacatcgaggagaagaggggcttcaccagccactttgtt
tttgtcatcgaggtcaaaacaaaaggagggtccaagtatctcatctaccgccgctatcgc
cagttctacgccctgcagagcaagctggaggagcggtttgggccagagagcaagaacagc
cctttcacctgcagcctgcccacattgccagccaaagtctacatgggcgcaaaacaagag
atcgctgagactcggatcccggccctcaatgcctacatgaagaacctcctgagcctgccg
gtctgcgtgctgatggaccccgacgtcaggatcttcttctatcagtctgcatacgatgct
gagcaggtgccccaggcactccgcaggctccgaccgcgcacgcgcaaaatcaagggtgtg
tctccacaaggggccatcatggatcgcatggaagcgccaagagcagaggccttgtttgac
ttcactgggaacagcaaattggagctaagtttcaaagctggagatgtgatcttccttctc
agtaagatcaacaaagactggctggagggcacctcccagggagccacaggcatcttccca
gggtccttcgtgaagatccttaaggactttcccgaggacgaggacaccaccaactggcta
cgatgctacttctatgaagacacaggcaaaaccatcaaggacattgcggtggaggaggac
ctcagcagcacgcccctgttcaaagacctgctagcgctcatgaggcgtgagttccagaga
gaagacattgcccttagctaccaggatgctgagggggacttggttaggctgctgtcagat
gaggatgtgggactcatggtgaagcaagcccgaggcctcccttcccagaagcgcctcttc
ccctggaagctgcatgtcacacagaaggacaactacagtgtctacaacactgtcccctga

KEGG   Mus musculus (mouse): 237038
Entry
237038            CDS       T01002                                 

Gene name
Nox1, GP91-2, MOX1, NOH-1, NOH1, NOX1a, NOX1alpha, Nox, Nox-1
Definition
(RefSeq) NADPH oxidase 1
  KO
K08008  NADPH oxidase 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    237038 (Nox1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    237038 (Nox1)
   05022 Pathways of neurodegeneration - multiple diseases
    237038 (Nox1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    237038 (Nox1)
   05418 Fluid shear stress and atherosclerosis
    237038 (Nox1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    237038 (Nox1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    237038 (Nox1)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    237038 (Nox1)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 NAD_binding_1 Tetraspanin FAD_binding_6 DUF6011
Other DBs
NCBI-GeneID: 237038
NCBI-ProteinID: NP_757340
MGI: 2450016
Ensembl: ENSMUSG00000031257
Vega: OTTMUSG00000019159
UniProt: Q8CIZ9
Position
X 55.69 cM; X E3
AA seq 563 aa
MGNWLVNHWLSVLFLVSWLGLNIFLFVYAFLNYEKSDKYYYTREILGTALALARASALCL
NFNSMMILIPVCRNLLSFLRGTCSFCNRTLRKPLDHNLTFHKLVAYMICIFTVIHIIAHL
FNFERYRRSQQAMDGSLASVLSSLSHPEKEDSWLNPIQSPNMTVMYAAFTSIAGLTGVIA
TVALVLMVTSAMEFIRRNYFELFWYTHHLFIVYIICLGIHGLGGIVRGQTEESLGESHPH
NCSHSFHEWDDHKGSCRHPHFAGHPPESWKWILAPIAFYIFERILRFYRSQQKVVITKVV
MHPSNVLELQMRKRGFSMEVGQYIFVNCPSISFLEWHPFTLTSAPEEEFFSVHIRAAGDW
TRNLIRTFEQQHSPMPRIEVDGPFGTVSEDVFQYEVAVLVGAGIGVTPFASILKSIWYKF
QRADNKLKTQKIYFYWICRETGAFAWFNNLLNSLEQEMEELGKMDFLNYRLFLTGWDSNI
AGHAALNFDRATDILTGLKQKTSFGRPMWDNEFSRIATAHPKSAVGVFLCGPRTLAKSLR
KRCQRYSSLDPRKVQFYFNKETF
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgggaaactggctggttaaccactggctctcagttttgtttctggtttcctggttgggg
ctgaacatttttctgtttgtgtatgccttcctgaattatgagaagtctgacaagtactat
tacacgagagaaattcttgggactgccttggccttggccagagcatctgctctgtgcttg
aattttaacagcatgatgatcctgattcctgtgtgtcgaaatctgctgtccttcttgagg
ggcacctgctcattttgcaaccgtacactgagaaagccattggatcacaacctcaccttc
cataagctggtggcatatatgatctgcatattcacagttattcatatcattgcacaccta
tttaacttcgaacgctacagaagaagccaacaggccatggatggatctctcgcttctgtt
ctctccagcctatctcatcctgagaaagaagattcttggctaaatcccatccagtctcca
aacatgacagtgatgtatgcagcatttaccagtattgctggccttactggagtgattgcc
actgtagctttggttctcatggtaacgtcagctatggagtttatccgcaggaattatttt
gagctcttttggtatacacatcacctttttatcgtctatatcatctgcttagggatccat
ggcctgggtgggattgtccggggtcaaacagaggagagcttgggtgaaagccatcctcac
aattgttcccattcttttcacgagtgggatgaccataaggggagttgcaggcatcctcat
tttgcggggcacccccctgagtcttggaagtggatccttgcaccgattgctttttatata
tttgaaaggatccttcgcttttatcgctcccagcagaaggtcgtgattaccaaggttgtc
atgcacccatctaatgttttggaattgcagatgaggaagcgaggctttagcatggaagta
ggacagtatatatttgtaaattgcccctccatttccttcctggagtggcatcccttcact
ctgacttctgctccagaggaagaatttttctccgttcatattcgagcagcaggggactgg
acacgaaatctcataaggacatttgaacaacagcactcaccaatgcccaggatcgaggtg
gacggtccctttggcacagtcagtgaggatgttttccagtatgaagtggctgtactggtt
ggggcagggattggggtcactccctttgcttccatcttgaaatctatctggtacaaattc
cagcgtgccgacaacaagctcaaaacacaaaagatctatttctactggatctgtagagag
acaggtgcctttgcctggttcaacaacttattgaattccctggaacaagagatggaggaa
ttaggcaaaatggattttctaaactaccgtctcttcctcactggctgggatagcaacatt
gctggtcatgcagcattaaactttgacagagccactgacatcctgacaggtctgaagcag
aaaacttcctttgggagaccaatgtgggacaatgagttttctagaatagctactgcccac
cccaagtctgcggtgggggttttcttatgtggccctcggactttggcaaaaagcctgcgc
aaacgctgtcagcgatactcgagtctggatcctaggaaggttcagttctacttcaacaaa
gaaacgttctga

DBGET integrated database retrieval system