KEGG   Mus musculus (mouse): 13058
Entry
13058             CDS       T01002                                 

Gene name
Cybb, C88302, CGD91-phox, Cgd, Cyd, No, Nox2, gp91-1, gp91<ph, gp91p, gp91phox
Definition
(RefSeq) cytochrome b-245, beta polypeptide
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04145  Phagosome
mmu04216  Ferroptosis
mmu04217  Necroptosis
mmu04613  Neutrophil extracellular trap formation
mmu04621  NOD-like receptor signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05140  Leishmaniasis
mmu05171  Coronavirus disease - COVID-19
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    13058 (Cybb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    13058 (Cybb)
  09143 Cell growth and death
   04216 Ferroptosis
    13058 (Cybb)
   04217 Necroptosis
    13058 (Cybb)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    13058 (Cybb)
   04621 NOD-like receptor signaling pathway
    13058 (Cybb)
   04670 Leukocyte transendothelial migration
    13058 (Cybb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    13058 (Cybb)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    13058 (Cybb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13058 (Cybb)
   05020 Prion disease
    13058 (Cybb)
   05022 Pathways of neurodegeneration - multiple diseases
    13058 (Cybb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    13058 (Cybb)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    13058 (Cybb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13058 (Cybb)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     13058 (Cybb)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    13058 (Cybb)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Other DBs
NCBI-GeneID: 13058
NCBI-ProteinID: NP_031833
MGI: 88574
Ensembl: ENSMUSG00000015340
Vega: OTTMUSG00000016894
UniProt: Q61093 Q3U6G0
Position
X; X A1.1
AA seq 570 aa
MGNWAVNEGLSIFVILVWLGLNVFLFINYYKVYDDGPKYNYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHL
FNVEWCVNARVGISDRYSIALSDIGDNENEEYLNFAREKIKNPEGGLYVAVTRLAGITGI
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLEEHN
LDICADKIEEWGKIKECPVPKFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCDNATSLKLKKIYFYWLCRDTHAFEWFADLLQLLETQMQERNNANFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASEHPNTTIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgaaggactctccatctttgtcattctggtgtggttgggg
ctgaatgtcttcctctttatcaactactacaaggtttatgatgatgggcctaagtataat
tatactcgaaaactccttgggtcagcactggctctggcccgggcacctgcagcctgcctg
aatttcaactgtatgctgatcctgctgccagtgtgtcgaaatctgctctcctttctcagg
ggttccagtgcgtgttgctcgacaaggattcgaagacaactggacaggaacctcactttc
cataagatggtagcttggatgatagcactgcacaccgccatccacacaattgcacatctc
ttcaacgttgagtggtgtgtgaatgccagagtcgggatttctgaccggtattcaatagct
ctctctgacatcggtgacaatgagaacgaagagtatctcaattttgctagagaaaaaatc
aagaaccctgaagggggcctgtatgtggccgtgactcggttggctgggatcacaggaatt
gtcatcacactgtgtctcatattgattatcacatcctctaccaaaaccattcggaggtct
tattttgaagtgttctggtatacacaccatctctttgtgatcttcttcatcggccttgcc
atccatggagctgaacgaattgtacgtggacagactgcggagagtttggaagagcataat
ttagatatctgtgcagacaaaatcgaagaatggggaaaaataaaggagtgcccagtacca
aagttcgctggaaaccctcctatgacttggaaatggatagtgggtcctatgttcctgtac
ctttgtgagaggttggttcggttttggcgatctcagcaaaaggtggtcatcaccaaggtg
gtcacccaccctttcaaaaccattgagcttcagatgaagaagaagggattcaagatggag
gtgggacagtacatttttgtcaagtgccccaaggtatccaagttagaatggcacccattc
acactgacctctgctcctgaggaagacttttttagcatccatatccgtattgtgggagac
tggacggaggggctattcaatgcttgtggctgtgataagcaggagttccaagatgcctgg
aaactacctaagatagcagttgatggaccctttggtacagccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagccgggattggagtcacgccctttgcctccattctc
aagtctgtctggtacaaatattgtgataatgccaccagtctgaaactcaaaaagatctac
ttctactggctgtgcagggacacgcatgcctttgagtggtttgcagacctgctgcagctg
ctggagacccagatgcaggaaaggaacaatgccaacttcctcagctacaatatctacctt
actggctgggatgaatctcaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggcctaaaacagaagactctgtatggacggcccaactgggataacgagttc
aagaccattgcaagtgaacaccctaacaccacaataggcgttttcctgtgtggccctgaa
gccttggctgaaactctcagtaaacagagcatctccaactcagaatccggcccgcgtgga
gtccacttcattttcaacaaggaaaacttctaa

DBGET integrated database retrieval system