KEGG   Mus musculus (mouse): 13067Help
Entry
13067             CDS       T01002                                 

Gene name
Cyct, T-Cc
Definition
(RefSeq) cytochrome c, testis
  KO
K08738  cytochrome c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer's disease
mmu05012  Parkinson's disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington's disease
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05222  Small cell lung cancer
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    13067 (Cyct)
   04215 Apoptosis - multiple species
    13067 (Cyct)
   04115 p53 signaling pathway
    13067 (Cyct)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    13067 (Cyct)
   05210 Colorectal cancer
    13067 (Cyct)
   05222 Small cell lung cancer
    13067 (Cyct)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    13067 (Cyct)
   05012 Parkinson's disease
    13067 (Cyct)
   05014 Amyotrophic lateral sclerosis (ALS)
    13067 (Cyct)
   05016 Huntington's disease
    13067 (Cyct)
  Cardiovascular diseases
   05416 Viral myocarditis
    13067 (Cyct)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    13067 (Cyct)
  Infectious diseases
   05134 Legionellosis
    13067 (Cyct)
   05152 Tuberculosis
    13067 (Cyct)
   05164 Influenza A
    13067 (Cyct)
   05161 Hepatitis B
    13067 (Cyct)
   05168 Herpes simplex infection
    13067 (Cyct)
   05163 Human cytomegalovirus infection
    13067 (Cyct)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    13067 (Cyct)
   05145 Toxoplasmosis
    13067 (Cyct)
  Drug resistance
   01524 Platinum drug resistance
    13067 (Cyct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Motif
Other DBs
NCBI-GeneID: 13067
NCBI-ProteinID: NP_034119
MGI: 88579
Ensembl: ENSMUSG00000056436
Vega: OTTMUSG00000013135
UniProt: P00015
Structure
PDB: 

Position
2 C3; 2 44.94 cM
AA seq 105 aa AA seqDB search
MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW
SEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagatctttgttcagaaatgtgctcagtgccacacg
gtggaaaaaggcgggaaacacaagacaggtccaaatctctggggcctctttggtcgaaag
acaggacaagcaccaggattttcttacacggatgcaaacaagaacaaaggtgttatctgg
tcagaagaaactttgatggaatatttggagaacccgaagaaatatatccctggcactaaa
atgatctttgctggtatcaaaaagaagagtgagagagaagatctcattaagtatttaaaa
caggccacatcctcatga

DBGET integrated database retrieval system