KEGG   Mus musculus (mouse): 13070Help
Entry
13070             CDS       T01002                                 

Gene name
Cyp11a1, Cyp11a, Cypxia1, D9Ertd411e, P450scc, Scc, cscc
Definition
(RefSeq) cytochrome P450, family 11, subfamily a, polypeptide 1
  KO
K00498  cholesterol monooxygenase (side-chain-cleaving) [EC:1.14.15.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu01100  Metabolic pathways
mmu04913  Ovarian steroidogenesis
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing's syndrome
Module
mmu_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13070 (Cyp11a1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    13070 (Cyp11a1)
   04925 Aldosterone synthesis and secretion
    13070 (Cyp11a1)
   04927 Cortisol synthesis and secretion
    13070 (Cyp11a1)
 Human Diseases
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    13070 (Cyp11a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.6  cholesterol monooxygenase (side-chain-cleaving)
     13070 (Cyp11a1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP11 family
   13070 (Cyp11a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 13070
NCBI-ProteinID: NP_062753
MGI: 88582
Ensembl: ENSMUSG00000032323
Vega: OTTMUSG00000045946
UniProt: Q9QZ82
Position
9 B; 9 31.63 cM
AA seq 526 aa AA seqDB search
MLAKGLSLRSVLVKGCQPFLSPTWQGPVLSTGKGAGTSTSSPRSFNEIPSPGDNGWLNLY
HFWRESGTQKIHYHQMQSFQKYGPIYREKLGTLESVYIVDPKDASILFSCEGPNPERFLV
PPWVAYHQYYQRPIGVLFKSSDAWKKDRIVLNQEVMAPGAIKNFVPLLEGVAQDFIKVLH
RRIKQQNSGNFSGVISDDLFRFSFESISSVIFGERMGMLEEIVDPEAQRFINAVYQMFHT
SVPMLNLPPDFFRLLRTKTWKDHAAAWDVIFNKADEYTQNFYWDLRQKRDFSQYPGVLYS
LLGGNKLPFKNIQANITEMLAGGVDTTSMTLQWNLYEMAHNLKVQEMLRAEVLAARRQAQ
GDMAKMVQLVPLLKASIKETLRLHPISVTLQRYTVNDLVLRNYKIPAKTLVQVASFAMGR
DPGFFPNPNKFDPTRWLEKSQNTTHFRYLGFGWGVRQCLGRRIAELEMTILLINLLENFR
IEVQNLRDVGTKFSLILMPENPILFNFQPLKQDLGPAVTRKDNTVN
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctggctaaaggactttccctgcgctcagtgctggtcaaaggctgccaacctttcctg
agccctacgtggcagggtccagtgctgagtactggaaagggagctggtacctctactagc
agtcctaggtccttcaatgagatcccttcccctggcgacaatggttggctaaacctgtac
cacttctggagggagagtggcacacagaaaatccattaccatcagatgcagagtttccaa
aagtatggccccatttacagggagaagctgggcactttggagtcagtttacatcgtggac
cccaaggatgcgtcgatactcttctcatgcgagggtcccaacccggagcggttccttgtg
cccccctgggtggcctatcaccagtattatcagaggcccattggggtcctgtttaagagt
tcagatgcctggaagaaagaccgaatcgtcctaaaccaagaggtgatggcgcctggagcc
atcaagaacttcgtgcccctgctggaaggtgtagctcaggacttcatcaaagtcttacac
agacgcatcaagcagcaaaattctggaaatttctcaggggtcatcagtgatgacctattc
cgcttttcctttgagtccatcagcagtgttatatttggggagcgcatggggatgctggag
gagatcgtggatcccgaggcccagcggttcatcaatgctgtctaccagatgttccacacc
agtgtccccatgctcaacctgcctccagacttctttcgactcctcagaactaagacctgg
aaggaccatgcagctgcctgggatgtgattttcaataaagctgatgagtacacccagaac
ttctactgggacttaaggcagaagcgagacttcagccagtaccctggtgtcctttatagc
ctcctggggggcaacaagctgcccttcaagaacatccaggccaacattaccgagatgctg
gcaggaggggtggacacgacctccatgaccctgcagtggaacctttatgagatggcacac
aacttgaaggtacaggagatgctgcgggctgaagtcctggctgcccggcgccaggcccag
ggagacatggccaagatggtacagttggttccactcctcaaagccagcatcaaggagaca
ctgagactccaccccatctccgtgaccttgcagaggtacactgtgaatgacctggtgctt
cgtaattacaagattccagccaagactttggtacaggtggctagctttgccatgggtcga
gatccgggcttctttcccaatccaaacaagtttgacccaactcgttggctggaaaaaagc
caaaataccacccacttccggtacttgggctttggctggggtgttcggcagtgtctgggc
cggcggattgcggagctggagatgaccatcctccttatcaatctgctggagaacttcaga
attgaagttcaaaatctccgtgatgtggggaccaagttcagcctcatcctgatgcctgag
aaccccatcctcttcaacttccagcctctcaagcaggacctgggcccagccgtgaccaga
aaagacaacactgtgaactga

DBGET integrated database retrieval system