KEGG   Mus musculus (mouse): 13076
Entry
13076             CDS       T01002                                 

Gene name
Cyp1a1, AHH, AHRR, CP11, CYPIA1, P450-, P450-1
Definition
(RefSeq) cytochrome P450, family 1, subfamily a, polypeptide 1
  KO
K07408  cytochrome P450 family 1 subfamily A1 [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu00380  Tryptophan metabolism
mmu00830  Retinol metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu01100  Metabolic pathways
mmu04913  Ovarian steroidogenesis
mmu05204  Chemical carcinogenesis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    13076 (Cyp1a1)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    13076 (Cyp1a1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13076 (Cyp1a1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    13076 (Cyp1a1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    13076 (Cyp1a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    13076 (Cyp1a1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    13076 (Cyp1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13076 (Cyp1a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13076 (Cyp1a1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP1 family
   13076 (Cyp1a1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 13076
NCBI-ProteinID: NP_001129531
MGI: 88588
Ensembl: ENSMUSG00000032315
Vega: OTTMUSG00000063205
UniProt: P00184 Q05A20
Position
9 B; 9 31.34 cM
AA seq 524 aa
MPSMYGLPAFVSATELLLAVTVFCLGFWVVRATRTWVPKGLKTPPGPWGLPFIGHMLTVG
KNPHLSLTRLSQQYGDVLQIRIGSTPVVVLSGLNTIKQALVRQGDDFKGRPDLYSFTLIT
NGKSMTFNPDSGPVWAARRRLAQNALKSFSIASDPTSASSCYLEEHVSKEANYLVSKLQK
VMAEVGHFDPYKYLVVSVANVICAICFGQRYDHDDQELLSIVNLSNEFGEVTGSGYPADF
IPVLRYLPNSSLDAFKDLNDKFYSFMKKLIKEHYRTFEKGHIRDITDSLIEHCQDRKLDE
NANVQLSDDKVITIVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRDRQ
PRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTSLNGFYIPKGCCVFVNQWQVNH
DRELWGDPNEFRPERFLTPSGTLDKRLSEKVTLFGLGKRKCIGETIGRSEVFLFLAILLQ
QIEFKVSPGEKVDMTPTYGLTLKHARCEHFQVQMRSSGPQHLQA
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgccttccatgtatggacttccagccttcgtgtcagccacagagctgctcctggctgtc
accgtattctgccttggattctgggtggtcagagccacaagaacctgggttcccaaaggc
ctgaagactccaccagggccctggggcttgcccttcattggtcacatgctgactgtgggg
aagaacccacatctgtcactgacacggctgagtcagcagtatggggacgtgctgcagatc
cgcatcggctccactcctgtggtggtgctgagcggcctgaacaccatcaagcaggccctg
gtgaggcagggagatgacttcaagggccggccagacctctacagcttcacacttatcact
aatggcaagagcatgacttttaacccagactctggacccgtgtgggctgcccgccggcgc
ctggcccagaatgccctgaagagcttctccatagcctcggacccgacgtcagcatcctct
tgctacttggaggagcacgtgagcaaggaggctaactatctcgtcagcaaacttcagaag
gtgatggcagaggttggccactttgacccttacaagtatttggtcgtgtcagtagccaat
gtcatctgtgccatatgctttggccaacgttatgaccatgatgaccaagagctgctcagc
atagtcaatctgagcaatgagtttggggaggttactggctctggatacccagctgacttc
attcctgtcctccgttacctgcctaactcttccctggatgccttcaaggacttgaatgat
aagttctacagcttcatgaagaagttaatcaaagagcactacaggacatttgagaagggc
cacatccgggacatcacagacagcctcattgagcattgtcaggacaggaagctggacgag
aatgccaatgtccagctgtcagatgataaggtcatcacgattgttttggacctctttgga
gctgggtttgacacagtcacaactgctatctcgtggagcctcatgtacctggtaaccaac
cctagggtacagagaaagatccaggaggaactagacacagtgattggcagagatcggcag
ccccggctttctgacagacctcagctgccctatctggaggccttcattctggagaccttc
cggcattcatccttcgtccccttcaccatcccccacagcaccacaagagatacaagtctg
aatggcttctatatccccaaggggtgctgtgtctttgtgaaccagtggcaggttaaccat
gaccgggaactgtggggtgacccaaacgagttccggcctgaaaggtttctcacccccagc
ggcactctggacaagcgcttgagtgagaaggtcactctctttggtttgggcaagcgaaag
tgcatcggagagaccattggccgatcggaggtctttctcttcctggccatcttgctgcag
caaatagaatttaaggtgtctccaggggagaaggtggatatgactcctacctatgggctg
actttaaaacacgcccgctgtgaacacttccaagtgcagatgcggtcttctggtcctcag
catcttcaggcttag

DBGET integrated database retrieval system