KEGG   Mus musculus (mouse): 13082
Entry
13082             CDS       T01002                                 

Symbol
Cyp26a1, Cyp26, P450RA, P450RAI, RAH
Name
(RefSeq) cytochrome P450, family 26, subfamily a, polypeptide 1
  KO
K07437  cytochrome P450 family 26 subfamily A [EC:1.14.14.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13082 (Cyp26a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13082 (Cyp26a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     13082 (Cyp26a1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP26 family
   13082 (Cyp26a1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 13082
NCBI-ProteinID: NP_031837
MGI: 1096359
Ensembl: ENSMUSG00000024987
UniProt: O55127 A0A0R4J061
Position
19; 19 C2
AA seq 497 aa
MGLPALLASALCTFVLPLLLFLAALKLWDLYCVSSRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GAGCLSNLHDSSHKQRKKVIMQAFSREALQCYVPVIAEEVSSCLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPGPAGGGEDEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGVKAR
NLIHARIEENIRAKIRRLQATEPDGGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREEIKSKGLLCKSNQDNKLDMETLEQLKYTGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVADIFTNKEEFNPDRFI
VPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFQGDI
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggggctcccggcgctgctggccagtgcgctctgcaccttcgtgctgccgctgctgctc
ttcctggcggcgctcaagctctgggacctgtactgtgtgagcagccgcgatcgcagctgc
gccctccccttgccccccggtaccatgggcttcccattctttggggaaacattgcagatg
gtgcttcagcggaggaagtttctgcagatgaagcgcaggaaatacggcttcatctacaag
acgcatctgtttgggcggcccacggtgcgggtgatgggcgcggataatgtgcggcgcatc
ttgctgggagagcaccggttggtgtcggtgcactggcccgcgtcggtgcgcaccatcctg
ggcgctggctgcctctccaacctgcacgattcctcgcacaagcagcgaaagaaggtgatt
atgcaggccttcagccgcgaggcactccagtgctacgtgcccgtgatcgctgaggaagtc
agcagttgtctggagcagtggctaagctgcggcgagcgcggcctcctggtctaccccgag
gtgaagcgcctcatgttccgcatcgccatgcgcatcctgctgggctgcgagccgggtcca
gcgggcggcggggaggacgagcagcagctcgtggaggctttcgaggagatgacccgcaat
ctcttctctcttcccattgacgtgccctttagcggcctgtaccggggcgtgaaggcgcgg
aaccttatacacgcgcgcatcgaggagaacattcgcgccaagatccgccggcttcaggct
acagagccggatgggggttgcaaggacgcgctgcagctcctgattgagcactcgtgggag
aggggagagaggctggatatgcaggcactaaaacaatcgtcaacagagctcctctttggt
ggtcatgaaactacagccagtgctgcgacgtcactgatcacttacctaggactctaccca
catgtcctccagaaagttcgagaagagataaagagcaagggcttactttgcaagagcaat
caagacaacaagttagacatggaaactttggaacagcttaaatacactgggtgtgtcatt
aaggagaccctgcgattgaatcctccggttccaggagggtttcgggttgctctgaagact
tttgagctgaatggataccagatccccaagggctggaatgttatttacagtatctgtgac
acccacgatgtggcagatatcttcactaacaaggaggaatttaatcccgaccgctttata
gtgcctcatccagaggatgcttcccggttcagcttcattccatttggaggaggccttcgg
agctgtgtaggcaaagagtttgcaaaaattcttcttaagatatttacagtggagctggct
aggcactgtgattggcagcttctaaatggacctcctacaatgaagacaagccccactgtg
taccctgtggacaatctccctgcaagatttacccacttccagggagatatctga

DBGET integrated database retrieval system