KEGG   Mus musculus (mouse): 13099Help
Entry
13099             CDS       T01002                                 

Gene name
Cyp2c40, AI265721, AI662255
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 40
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu04726  Serotonergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    13099 (Cyp2c40)
   00590 Arachidonic acid metabolism
    13099 (Cyp2c40)
   00591 Linoleic acid metabolism
    13099 (Cyp2c40)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13099 (Cyp2c40)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    13099 (Cyp2c40)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    13099 (Cyp2c40)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    13099 (Cyp2c40)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13099 (Cyp2c40)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13099 (Cyp2c40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 13099
NCBI-ProteinID: NP_034134
MGI: 1306815
Ensembl: ENSMUSG00000025004
Vega: OTTMUSG00000028294
UniProt: P56657 E9Q7C8
Position
19; 19 C3
AA seq 520 aa AA seqDB search
MPKRKILICECCIKCLECLIIPVSVRRVSMDPFVVLVLCLSFLLVLSLWRQRSARGNLPP
GPTPLPIIGNYHLIDMKDIGQCLTNFSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHG
EEFSGRGRIPVFDKVSTGKGIGFSHGNVWKATRVFTVNTLRNLGMGKRTIENKVQEEAQW
LMKELKKTNGSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKVNECTEILSSP
GCQIFNAVPILIDYCPGSHNKLFKNHTWIKSYLLGKIKEHEESLDVTNPRDFIDYFLIQR
RQKNGIEHMDYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVI
GRHRSPCMQDRNHMPYTNAMVHEVQRYIDLGPNGVVHEVTCDTKFRNYFIPKGTQVMTSL
TSVLHDSTEFPNPEVFDPGHFLDDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTT
ILQNFKLKPLVDPKDIDMTPKHSGFSKIPPNFQMCFIPVE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacgcaaaatattgatttgcgaatgctgtataaagtgtctggagtgcctgatc
ataccagtgtcagtaagaagggtctccatggatccatttgtagtcttggtgctttgtctg
tcctttctgcttgtcctgtcattgtggagacagagatctgcaagagggaacctccctcct
ggccctactcctctcccaattattggaaattaccacctgatagatatgaaggacattggg
cagtgccttaccaatttttctaaaacatatggccctgtgttcactctgtattttggctca
cagcctattgtggtattacatggttatgaggcaattaaagaagccctcattgaccatgga
gaagagttctctggaagaggaaggattccggtttttgacaaggtttctacaggaaagggc
attggttttagccatggaaatgtatggaaagccacaagggtcttcacagtgaataccttg
aggaacttgggcatgggaaaaaggaccattgagaacaaagtgcaagaggaagcacagtgg
ctcatgaaggaactgaagaaaacaaatggctcaccctgtgatccccaattcatcatagga
tgtgctccctgcaatgtcatctgctccattgttttccagaatcgtttcgattataaggat
aaggattttcttagcttgataggaaaagtgaatgaatgcactgaaattttgagctctcct
gggtgtcagattttcaatgcagtccctattcttattgattattgtccaggaagtcataat
aaactttttaaaaatcatacatggattaagagctatcttttggggaaaataaaagaacat
gaagaatcattggatgttacaaatcctcgggacttcattgattacttcctaattcaaaga
cgtcagaaaaatggcattgagcacatggactataccattgaacacctggcaacattggtg
actgatctggtttttggtgggacagagaccttaagctcaacgatgagatttgctctcctg
ctcttgatgaagcacacacacatcacagctaaagtccaggaagagattgacaatgtgatt
gggagacaccgcagcccctgtatgcaggacaggaaccacatgccttacacaaatgccatg
gtgcatgaggtccagcggtacattgaccttggcccaaatggtgtggtgcatgaagtaacc
tgtgacactaagttcagaaactacttcatccccaagggaacacaggtaatgacatcactg
acatcagtgctgcatgacagcacggagttccccaacccagaggtgtttgaccctggccac
tttctagatgacaatggaaactttaagaaaagtgactacttcgtgcctttctcagcagga
aaacggatttgtgtgggagagagccttgcccgcatggagctgtttctattcctgaccacc
attttacagaatttcaaactgaaacctctggttgatccaaaggacatcgatatgaccccc
aaacattctggattttctaaaattcctcccaatttccagatgtgctttatccctgtggaa
tga

DBGET integrated database retrieval system