KEGG   Mus musculus (mouse): 13101Help
Entry
13101             CDS       T01002                                 

Gene name
Cyp2d10, AI303445, Cyp2d, P450-2D
Definition
(RefSeq) cytochrome P450, family 2, subfamily d, polypeptide 10
  KO
K07414  cytochrome P450 family 2 subfamily D [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    13101 (Cyp2d10)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    13101 (Cyp2d10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13101 (Cyp2d10)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     13101 (Cyp2d10)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   13101 (Cyp2d10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 13101
NCBI-ProteinID: NP_034135
MGI: 88602
Ensembl: ENSMUSG00000094806
UniProt: P24456
Position
15 E1; 15 38.58 cM
AA seq 504 aa AA seqDB search
MELLTGAGLWSVAIFTVIFILLVDLMHRHQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYS
LYKLQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADRPQVPIFEYLGVKPGSQ
GVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEARHLCDAFTAQAGQPINPNTM
LNNAVCNVIASLIFARRFEYEDPYLIRMQKVLEDSLTEISGLIPEVLNMFPILLRIPGLP
GKVFQGQKSLLAIVENLLTENRNTWDPDQPPRNLTDAFLAEIEKVKGNAESSFNDENLRM
VVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRVQQEIDAVIGQVRHPEMADQARMPYTN
AVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPKGSILIPNMSSVLKDETVWEKPLRFHP
EHFLDAQGHFVKPEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQHFSFSVPNGQPRPRN
LGVFPFPVAPYPYQLCAVMREQGH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgactggggctggcctgtggtctgtggccatattcaccgttatcttcata
ttactggtggacctgatgcaccggcaccagcgctggacttctcgctacccaccgggccct
gtgccatggcctgtgctgggtaacctgctgcaggtggacctggataacatgccatacagc
ttgtacaagcttcaaaaccgctatggtgacgtgttcagcctgcagatgggctggaagcct
atggttgtgatcaatggactgaaggcaatgaaggaagtgctgttgacctgtggagaggac
actgctgaccgccctcaagtgcccatctttgagtacctgggtgtgaagcctggatcccaa
ggtgtggtccttgcaccctacgggcccgagtggcgagagcagaggcgattctctgtgtct
accctgcgcaactttggcctgggcaagaaatcactggaggactgggtgaccaaggaggcc
agacacctctgtgatgccttcaccgcccaggctgggcagcccatcaatcccaacaccatg
ctgaacaacgctgtgtgcaatgtgattgcatctctcatttttgcccgtcgctttgaatat
gaagacccttacctcatcaggatgcagaaagtactggaagatagtttgacagaaatctct
ggcttaattcctgaggttcttaatatgttccccatactcctgcgcatcccaggactgcct
gggaaggtcttccaaggtcagaagtccttactggccatagtggagaatctgttgactgag
aataggaacacctgggaccctgaccagccaccccgaaatttgactgatgccttcctggca
gagatagagaaggtaaaggggaatgctgagagcagcttcaatgatgagaacctgcgcatg
gttgtgctagacctgttcactgcagggatggtgaccacctcaaccacactgtcctgggcc
ctgctgctcatgatcctgcatccggatgtgcagcgcagagtccaacaggaaatcgatgcg
gtcatagggcaggtgcggcatccagagatggcagaccaggctcgtatgccctacaccaat
gctgtcattcatgaggtacagcgctttggggacattgctccactgaatttgccacgcatc
acaagtcgtgacattgaagtgcaggacttcctcatccccaaggggtcaatcctcatcccc
aacatgtcctccgtgctgaaggatgagactgtctgggaaaagcccctccgcttccatcct
gaacacttcctcgatgcccagggccactttgtgaagcctgaggccttcatgccattctca
gcaggccgcagatcatgcctgggtgagcccctggcccgcatggagctcttcctcttcttc
acgtgcctcctgcagcactttagcttctcagtgcccaatggacagcccaggcctagaaac
cttggtgtctttccttttccggttgccccctacccctaccagctctgtgctgtgatgcgt
gagcaaggacactaa

DBGET integrated database retrieval system