KEGG   Mus musculus (mouse): 13118Help
Entry
13118             CDS       T01002                                 

Gene name
Cyp4a12b, BC060945, Cyp4a12
Definition
(RefSeq) cytochrome P450, family 4, subfamily a, polypeptide 12B
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00590  Arachidonic acid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    13118 (Cyp4a12b)
   00590 Arachidonic acid metabolism
    13118 (Cyp4a12b)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13118 (Cyp4a12b)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    13118 (Cyp4a12b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    13118 (Cyp4a12b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    13118 (Cyp4a12b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13118 (Cyp4a12b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     13118 (Cyp4a12b)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   13118 (Cyp4a12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 YihI
Motif
Other DBs
NCBI-GeneID: 13118
NCBI-ProteinID: NP_758510
MGI: 3611747
Ensembl: ENSMUSG00000078597
Vega: OTTMUSG00000008618
UniProt: B0G0Y1 A2A974 B0G0Y2
Position
4; 4 D1
AA seq 508 aa AA seqDB search
MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLF
GHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKAHGSYRF
LAPWIGRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQIVGQDST
LEIFQHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNNLFFLRVRNIFHQNDII
YRVSSNGCLANSACQLAHDHTDQVIKSRRSQLQDEEELEKLKKKRRLDFLDILLFARMEN
GKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGASIT
WNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNP
TVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLP
DPTRVPIPIPRIVLKSKNGIHLHLKKLQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctctgctctgagctccatcagattcccaggaagcatctctgagtaccttcaa
gtagcctctgtgctcagcctgctcctgctgctcttcaagacagcccagctctacctgcac
aggcaatggctactcagcagtactcagcagttcccatccccaccttctcactggctcttt
ggacacaagatcttaaaggaccaggaccttcaagatattctaactaggattaagaatttc
ccaagtgcctgtccacagtggctctggggaagcaaagtgcgcattcaagtgtatgaccct
gactacatgaagctgattctggggagatcagacccaaaagctcatggttcctacagattt
ctagctccctggattgggcgtggtttgcttctgctggatggacagacatggtttcagcac
cgacgaatgttgaccccagctttccactatgacattctgaagccttacacggaaatcatg
gcagactctgttcatgtcatgctggataaatgggaacagattgttggccaggattccacc
ctggagatcttccaacacatcaccttgatgaccttggacaccatcatgaagtgtgccttc
agccatgagggcagtgtccagttggacagaaaatacaagtcctatatccaggcagttgag
gacctgaacaatctcttttttctccgtgtgcggaacatctttcaccagaatgacatcatc
tacagagtgtcctctaatggctgcttggccaacagtgcctgccaacttgcccatgatcac
acagaccaagtgatcaaatcaaggaggagtcaacttcaggatgaggaagagttggaaaag
cttaagaagaaaaggcgattggatttcctggacatcctcctatttgccagaatggaaaat
ggaaaaagcttatctgataaggaccttcgtgctgaagtggatactttcatgttcgagggc
catgacaccacagctagtggtatctcctggatcttctatgctttggccacaaatcctgaa
catcaacagagatgcaggaaggagatccaaagtctcttaggagatggggcttctatcacc
tggaacgacctggacaagatgccctatactaccatgtgcatcaaggaggccctgaggatc
tacccccctgtaccaagtgtgagcagagagctcagctcacctgtcacctttcctgatgga
cgttctttacccaaaggtatccatgtcatgctctccttttatggccttcatcacaaccca
actgtgtggccaaatccagaggtgtttgatccttctcgatttgcaccagggtcttcccgg
cacagccactcattcctgcccttctcaggaggagcaaggaactgcattgggaaacagttt
gcgatgaatgagctgaaggtggctgtggccctgaccctgctccgctttgagctgctgcca
gatcccaccagagtcccaatccccataccaagaattgtgttgaagtccaagaatgggatc
cacttgcatctcaaaaagctccaataa

DBGET integrated database retrieval system