KEGG   Mus musculus (mouse): 13121
Entry
13121             CDS       T01002                                 

Symbol
Cyp51, AI426508, CYPLI, Cyp51a1, Ldm, P450-14DM, P450LI
Name
(RefSeq) cytochrome P450, family 51
  KO
K05917  sterol 14alpha-demethylase [EC:1.14.14.154 1.14.15.36]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00100  Steroid biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    13121 (Cyp51)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13121 (Cyp51)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.154  sterol 14alpha-demethylase
     13121 (Cyp51)
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.36  sterol 14alpha-demethylase (ferredoxin)
     13121 (Cyp51)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP51 family
   13121 (Cyp51)
SSDB
Motif
Pfam: p450 MRPL52
Other DBs
NCBI-GeneID: 13121
NCBI-ProteinID: NP_064394
MGI: 106040
Ensembl: ENSMUSG00000001467
Vega: OTTMUSG00000022725
UniProt: Q8K0C4
Position
5 A1; 5 2.3 cM
AA seq 503 aa
MVLLGLLQSGGWVLGQAMEQVTGGNLLSTLLIACAFTLSLVYLFRLAVGHMVQLPAGAKS
PPHIYSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNS
KNEDLNAEEVYGRLTTPVFGKGVAYDVPNAIFLEQKKIIKSGLNIAHFKQYVPIIEKEAK
EYFQSWGESGERNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFTHAAWL
LPAWLPLPSFRRRDRAHREIKNIFYKAIQKRRLSKEPAEDILQTLLDSTYKDGRPLTDEE
ISGMLIGLLLAGQHTSSTTSAWMGFFLAKDKPLQEKCYLEQKAVCGEDLPPLTYDQLKDL
NLLDRCIKETLRLRPPIMTMMRMAKTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWAERLD
FNPDRYLQDNPASGEKFAYVPFGAGRHRCVGENFAYVQIKTIWSTMLRLYEFDLINGYFP
TVNYTTMIHTPENPVIRYKRRSK
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggtacttctgggcttgctgcagtcaggcggctgggtgctcggacaggcgatggagcag
gtgacaggaggcaacttgctttccacgctgctcatcgcctgcgccttcactctcagcctc
gtctacctgttccgtctcgccgtgggccacatggtccagctgcccgctggagcgaaaagt
ccaccacatatttactctccaattccattccttggccatgcaatagcatttgggaaaagt
ccaattgagtttctggaaaatgcatatgagaagtatggacctgtgtttagctttaccatg
gtgggcaagaccttcacttaccttctggggagtgatgcagctgcgctgctcttcaatagt
aaaaacgaagacctgaatgcagaagaagtctacggtcggctgacaacacctgtgtttggg
aagggagttgcatatgatgtgccaaatgcaattttcttggaacagaagaaaatcataaaa
agtggccttaacatagcccactttaagcagtatgttcctatcattgaaaaagaagcaaag
gaatactttcaaagttggggagaaagcggagaaagaaatgtgtttgaagcactgtctgag
ctcataattttgacagctagccattgtttacatggaaaggaaattagaagtcaactcaac
gagaaggtggctcagctgtacgcagacctggatggaggttttacccacgctgcctggcta
ttgccagcttggctgcctctgccaagtttcaggcgcagggatagagcccatcgagagatc
aagaatattttctataaggccatccagaagcgcaggctgtcaaaagaaccagctgaggac
attcttcaaactttactagattctacatacaaggacgggcgtcctctaacagatgaggag
atatcagggatgctcatcggactgctgctggctggacagcacacatcctccaccaccagt
gcctggatgggcttctttctggccaaagataaaccacttcaagaaaaatgctacttagaa
cagaaagcagtgtgtggcgaggatctgcctcctttaacttacgaccagttgaaggatctg
aatttacttgatagatgcataaaagaaacactaagactgaggcctccaataatgaccatg
atgagaatggccaagacccctcagacggtggcagggtacaccattcctccaggacatcag
gtgtgtgtctctcctactgtcaatcaaagactgaaagactcctgggcagagcgcttggac
tttaatcctgaccgctacttacaggataacccagcatcaggagagaagtttgcctatgtg
ccatttggagctgggcgtcatcgttgtgttggagaaaattttgcctatgttcaaattaag
acaatttggtcgactatgcttcgtttatatgaatttgacctcatcaatggatattttccc
actgtgaattatacaacaatgatccacaccccagaaaacccagtaatccgttacaaacga
cgatcaaaatga

DBGET integrated database retrieval system