KEGG   Mus musculus (house mouse): 13123
Entry
13123             CDS       T01002                                 
Symbol
Cyp7b1, AW261589, D3Ertd552e, hct-1
Name
(RefSeq) cytochrome P450, family 7, subfamily b, polypeptide 1
  KO
K07430  25/26-hydroxycholesterol 7alpha-hydroxylase [EC:1.14.14.29]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    13123 (Cyp7b1)
   00140 Steroid hormone biosynthesis
    13123 (Cyp7b1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13123 (Cyp7b1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.29  25/26-hydroxycholesterol 7alpha-hydroxylase
     13123 (Cyp7b1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP7 family
   13123 (Cyp7b1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 13123
NCBI-ProteinID: NP_031851
MGI: 104978
Ensembl: ENSMUSG00000039519
UniProt: Q60991 Q3USU4
Position
3:complement(18126108..18298054)
AA seq 507 aa
MQGATTLDAASPGPLALLGLLFAATLLLSALFLLTRRTRRPREPPLIKGWLPYLGMALKF
FKDPLTFLKTLQRQHGDTFTVFLVGKYITFVLNPFQYQYVTKNPKQLSFQKFSSRLSAKA
FSVKKLLTDDDLNEDVHRAYLLLQGKPLDALLETMIQEVKELFESQLLKITDWNTERIFA
FCGSLVFEITFATLYGKILAGNKKQIISELRDDFFKFDDMFPYLVSDIPIQLLRNEESMQ
KKIIKCLTSEKVAQMQGQSKIVQERQDLLKRYYRHDDPEIGAHHLGFLWASLANTIPAMF
WAMYYILRHPEAMEALRDEIDSFLQSTGQKKGPGISVHFTREQLDSLVCLESTILEVLRL
CSYSSIIREVQEDMNLSLESKSFSLRKGDFVALFPPLIHNDPEIFDAPKEFRFDRFIEDG
KKKSTFFKGGKKLKTYVMPFGLGTSKCPGRYFAVNEMKLLLIMLLTYFDLEIIDRKPIGL
NHSRMFLGIQHPDSAVSFRYKAKSWRS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgcagggagccacgaccctagatgccgcctcgccagggcctctcgccctcctaggcctt
ctctttgccgccaccttactgctctcggccctgttcctccttacccggcgcaccaggcgc
cctcgtgaaccacccttgataaaaggttggcttccttatcttggcatggccctgaaattc
tttaaggatccgttaactttcttgaaaactcttcaaaggcaacatggtgacactttcact
gtcttccttgtggggaagtatataacatttgttctgaaccctttccagtaccagtatgta
acgaaaaacccaaaacaattaagctttcagaagttcagcagccgattatcagcgaaagcc
ttctctgtaaagaagctgcttactgatgacgaccttaatgaagacgttcacagagcctat
ctacttctacaaggcaaacctttggatgctcttctggaaactatgatccaagaagtaaaa
gaattatttgagtcccaactgctaaaaatcacagattggaacacagaaagaatatttgca
ttctgtggctcactggtatttgagatcacatttgcgactctatatggaaaaattcttgct
ggtaacaagaaacaaattatcagtgagctaagggatgatttttttaaatttgatgacatg
ttcccatacttagtatctgacatacctattcagcttctaagaaatgaagaatctatgcag
aagaaaattataaaatgcctcacatcagaaaaagtagctcagatgcaaggacagtcaaaa
attgttcaggaaaggcaagatctgctgaaaagatactataggcatgacgatcctgaaata
ggagcacatcatcttggctttctctgggcctctctagcaaacaccattccagctatgttc
tgggcaatgtattatattcttcggcatcctgaagctatggaagccctgcgtgacgaaatt
gacagtttcctgcagtcaacaggtcaaaagaaaggacctggaatttcagtccacttcacc
agagaacaattggacagcttggtctgcctggaaagcactattcttgaggttctgaggctg
tgctcatactccagcatcatccgagaagtgcaggaggatatgaatctcagcttagagagt
aagagtttctctctgcggaaaggagattttgtagccctctttcctccactcatacacaat
gacccggaaatcttcgatgctccaaaggaatttaggttcgatcgcttcatagaagatggt
aagaagaaaagcacgtttttcaaaggagggaagaagctgaagacttacgttatgcctttt
ggactcggaacaagcaaatgtccagggagatattttgcagtgaacgaaatgaagttactg
ctgattatgcttttaacttattttgatttagaaattatcgacaggaagcctatagggcta
aatcacagtcggatgtttttaggtattcagcaccccgattctgccgtctcctttaggtac
aaagcaaaatcttggagaagctga

DBGET integrated database retrieval system