KEGG   Mus musculus (mouse): 13124
Entry
13124             CDS       T01002                                 

Symbol
Cyp8b1
Name
(RefSeq) cytochrome P450, family 8, subfamily b, polypeptide 1
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.14.139]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    13124 (Cyp8b1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    13124 (Cyp8b1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13124 (Cyp8b1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     13124 (Cyp8b1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP8 family
   13124 (Cyp8b1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 13124
NCBI-ProteinID: NP_034142
MGI: 1338044
Ensembl: ENSMUSG00000050445
Vega: OTTMUSG00000022966
UniProt: O88962 A0A0R4J0N7
Position
9 72.73 cM; 9 F4
AA seq 500 aa
MTLWCTVLGALLTVVGCLCLSLLLRHRRPWEPPLDKGFVPWLGHSMAFRKNMFEFLKGMR
AKHGDVFTVQLGGQYFTFVMDPLSFGPIIKNTEKALDFQSYAKELVLKVFGYQSVDGDHR
MIHLASTKHLMGQGLEELNQAMLDSLSLVMLGPKGSSLGASSWCEDGLFHFCYRILFKAG
FLSLFGYTKDKQQDLDEADELFRKFRRFDFLFPRFVYSLLGPREWVEVSQLQRLFHQRLS
VKQNLEKDGISCWLGYMLQFLREQGIASSMQDKFNFMMLWASQGNTGPTCFWVLLFLLKH
QDAMKAVREEATRVMGKARLEAKKSFTFTPSALKHTPVLDSVMEESLRLCATPTLLRVVQ
EDYVLKMASGQEYQIRRGDKVALFPYLSVHMDPDIHPEPTAFKYDRFLNPDGTRKVDFYK
SGKKIHHYSMPWGSGVSKCPGRFFALSEMKTFVLLMIMYFDFKLVDPDIPVPPIDPRRWG
FGTSQPSHEVRFLYRLKPVQ
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgacgctgtggtgtacagtgctaggagccctgctcacggttgtgggatgcctgtgtctg
tccttgctgctcaggcaccgcaggccctgggagccacctctggacaagggttttgtgccc
tggctgggtcactccatggctttccggaagaatatgtttgaattcttgaaggggatgcgg
gccaagcacggggatgtcttcacggtgcagctgggaggccagtacttcacctttgtcatg
gaccccctgtcctttggccccatcattaagaacacagagaaagcgctggacttccagtcc
tatgcaaaagaactggtgctcaaggtgtttgggtaccagtctgtagatggggatcacagg
atgatccacttagctagtaccaagcatctgatggggcaaggcttggaggaactcaaccag
gccatgctggacagcctatccttggtgatgctagggcctaaaggttcgagtctgggtgcc
agctcctggtgtgaagatggcctctttcacttctgctacagaatcctgtttaaggctggc
ttcctgagcttattcggctacaccaaggacaagcagcaagacctggatgaggccgatgag
ctgttcaggaagttccgtcgatttgactttctcttccccaggtttgtctactccctactg
gggccccgggagtgggtggaagtgagccagttgcagcgtctcttccatcagagactctct
gtgaagcaaaacctggaaaaagacggcataagctgttggttaggctacatgcttcagttt
ctgagggagcaaggaatagcttcatccatgcaggacaaatttaactttatgatgctctgg
gcctcccaggggaacacgggacccacctgtttctgggtcctcttattcctgctgaagcac
caggatgccatgaaggctgtgcgtgaggaagccaccagggtcatgggtaaggccaggctg
gaagccaagaagtcgttcactttcactcccagtgccctgaaacacactccagtgttggac
agcgtgatggaggagagtctgcgtctctgtgccacccccaccctcctcagggtggtacag
gaggattatgtcctgaagatggccagcggacaagagtaccagatccgtcgcggagataag
gtggctctcttcccctatctctcagtacacatggaccccgacatccaccctgagcccaca
gccttcaagtatgatcggttcctcaacccggatggcacccggaaagtggacttctacaag
tcgggcaagaagatccaccactacagcatgccttggggctcgggtgtttccaagtgcccc
ggcaggttctttgccctcagcgagatgaagacctttgtccttcttatgattatgtacttc
gacttcaagctggtcgaccccgacatacctgtgccccccattgacccaaggcgctggggc
tttggcacctcacagcctagccatgaggtacgcttcctctatcgcctgaagcccgtgcag
tga

DBGET integrated database retrieval system