KEGG   Mus musculus (house mouse): 13134
Entry
13134             CDS       T01002                                 
Symbol
Dach1, Dac, Dach
Name
(RefSeq) dachshund family transcription factor 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Ski_Sno
Other DBs
NCBI-GeneID: 13134
NCBI-ProteinID: NP_031852
MGI: 1277991
Ensembl: ENSMUSG00000055639
UniProt: Q9QYB2 Q3UTV2 Q80WU5
Position
14:complement(98024282..98407608)
AA seq 751 aa
MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPI
ASSASSSAAATVTSPGGGGGGSGGGGGSGGNGGGGGSNCNPSLAAGSSGGGVSAGGGGAS
STPITASTGSSSSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNE
CKMVDLRGAKVASFTVEGCELICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQ
VRILRGLGAIQPGVNRCKLISRKDFETLYNDCTNASSRPGRPPKRTQSVTSPENSHIMPH
SVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSE
NGDMNSSVGSSGGSWDKETLHSPPSQGSQAPVAHARMPAAFSLPVSHPLNHLQHSHLPPN
GLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVETSVIKER
VPDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGLS
PNVLPGPKEGDLAGHDMGHESKRIHIEKDETPLSTPTARDSIDKLSLTGHGQPLPPGFPS
PFLFPDGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQ
LAMEQKNRAIVQKRLKKEKKAKRKLQEALEFETKRREQAEQTLKQAASADSLRVLNDSLT
PEIEADRSGGRADAERTIQDGRLYLKTTVMY
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggcagtgccggcggctttgatccctccgacccagctggtcccccctcaacccccgatc
tctacttctgcttcctcctcgggcaccaccacctccacctcctcggcgacctcgtctccg
gctccatccatcggacccccggcgtcgtctgggccaactctgttccggccggagcccatt
gcctcttctgcttcttcttcagccgcggccacagtcacctctcctggtggcggcggcggc
ggcagcggaggcggcggtggcagcggcggcaacggaggcggcggcgggagcaactgcaac
cccagcctggcggccgggagcagcggcggcggcgttagcgctggcggcggcggcgcctcc
agcacccccatcaccgcgagcaccggcagcagcagcagtagcagcagcagcagcagcagt
agcagcagcagcagcagtagcagcagcagcagcagtagcagcagcagctgcggccccctc
cctgggaaacccgtgtactcaaccccgtccccagtggaaaacaccccccagaataatgag
tgcaaaatggtggatctgagaggggccaaagtggcttcctttacggtggagggctgcgag
ctgatctgcctgccccaggctttcgacctgttcctgaagcacttggtggggggcttgcac
accgtctacaccaagctgaagcggttggagatcacgccggtggtgtgcaatgtggaacag
gttcgcatcctgaggggactgggggccatccagcccggagtgaaccgctgcaaactcatc
tccaggaaggacttcgagaccctctacaatgactgcaccaacgccagttccagacctgga
aggcctcctaagaggactcaaagtgtcacttccccagagaactctcacatcatgccgcat
tctgtccctggcctcatgtctcctggaatcattccaccaacaggtctgactgcagctgct
gcagctgctgcagctgctaccaatgcagctattgctgaagcaatgaaggtgaaaaaaata
aaattagaagctatgagcaactatcatgccagtaacaaccaacatggagcagattctgaa
aacggggacatgaattcaagtgttggcagcagtggtggttcttgggataaggaaacactg
cactctcccccatcccagggatcccaggctcctgttgcacatgcccgcatgcctgcagcg
tttagccttccagttagccatcctctcaaccatctgcagcacagccaccttccgccaaat
ggactggaacttccttttatgatgatgccccaccctctcattcctgtcagcctacctcca
gcatctgtcaccatggcaatgagtcagatgaaccaccttagcaccattgcaaatatggcg
gcggcagcacaagttcagagtcctccatccagggtggagacatctgttattaaggagcgt
gttcccgacagtccctcgcctgctccatctctggaggagggccggaggcccggcagccac
ccatcctcacaccgcagcagcagtgtgtccagctccccggcgcggactgagagttcttcc
gacagaatccctgtccatcagaatggcctgtccatgaaccagatgcttatgggtttatcc
ccaaatgtgcttcctgggccaaaggagggggatttggctggtcatgacatggggcatgag
tcaaaacggatccacattgaaaaagatgagaccccactttccacaccaaccgcaagagac
agcatcgacaaactttctctaactgggcatggacaaccactacctcccggcttcccatct
ccctttctgtttcctgatggcctgtcctccatagagactcttctcactaacatacagggc
ctcttgaaagttgccatagacaatgccagagctcaagaaaagcaggtccaactggaaaaa
acagagctgaagatggattttttaagagaaagagaactaagagaaacactggagaagcag
ctggccatggaacaaaagaacagagccatagttcaaaagaggctaaagaaggaaaagaaa
gcaaagagaaaactgcaggaggcactagaatttgagacaaaacgccgtgagcaagcggag
cagacactgaaacaggcagcttcagcggacagtctccgggtcttaaatgactccctgacc
cctgagatagaagctgaccgcagcggagggagagcagatgctgaaaggacaatacaagat
ggaagactgtatttgaaaactactgtcatgtactga

DBGET integrated database retrieval system