KEGG   Mus musculus (mouse): 13138
Entry
13138             CDS       T01002                                 

Gene name
Dag1, D9Wsu13, D9Wsu13e, DG, Dp427, Dp71
Definition
(RefSeq) dystroglycan 1
  KO
K06265  dystroglycan 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    13138 (Dag1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    13138 (Dag1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    13138 (Dag1)
   05414 Dilated cardiomyopathy
    13138 (Dag1)
   05416 Viral myocarditis
    13138 (Dag1)
SSDB
Motif
Pfam: DAG1 a_DG1_N2 He_PIG ATP1G1_PLM_MAT8
Other DBs
NCBI-GeneID: 13138
NCBI-ProteinID: NP_001263410
MGI: 101864
Ensembl: ENSMUSG00000039952
Vega: OTTMUSG00000050793
UniProt: Q62165 Q544G5
Structure
PDB: 
4WIQ 5N4H 5N30 1U2C

Position
9 F1- F2; 9 59.08 cM
AA seq 893 aa
MSVDNWLLHPLWGQTFLLLLSVAVAQAHWPSEPSEAVRDWKNQLEASMHSVLSDFQEAVP
TVVGIPDGTAVVGRSFRVSIPTDLIASSGEIIKVSAAGKEALPSWLHWDPHSHILEGLPL
DTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHNEPQSVRAASSDPGEVVPSAC
AADEPVTVLTVILDADLTKMTPKQRIDLLNRMQSFSEVELHNMKLVPVVNNRLFDMSAFM
AGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVETPAREGAMSAQLGYPVVGWHIANK
KPTLPKRLRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPV
PGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTLTIPGYVEPTAVITPPTT
TTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRT
TTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLRE
QQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGD
KAPARFKARLAGDPAPVVNDIHKKIALVKKLAFAFGDRNCSSITLQNITRGSIVVEWTNN
TLPLEPCPKEQIIGLSRRIADENGKPRPAFSNALEPDFKALSIAVTGSGSCRHLQFIPVA
PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPETTPL
NQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgtctgtggacaactggctactgcaccccctctggggacagacctttctcctcctcctg
tctgtggctgtggctcaggcccactggcccagtgaaccctcagaggctgtgagggactgg
aagaaccagcttgaggcgtccatgcactcagttctctccgacttccaggaggctgttccc
accgtggttggcattccagacggtacggctgttgtcgggcgctcatttcgagtgagcatt
ccaacggatttaattgcctccagtggggagatcatcaaggtgtctgcagcagggaaggag
gccttaccgtcttggctacactgggacccacacagtcatattttggaaggccttcctctt
gacactgataaaggtgtgcattacatctcagtgagtgctgcacgcctgggagccaatgga
agccacgtcccccagacttccagtgtgttctctatcgaggtctaccctgaagaccacaat
gagccacagtctgtacgggcagcctcatcagaccctggtgaggtagtgccatctgcctgt
gctgctgatgagccagtgactgtccttacagtgattctggatgctgacctcaccaagatg
accccaaagcaaaggatcgatctgttgaacagaatgcagagcttctcagaagtagaactt
cacaacatgaagttggtgcctgtagtgaataatagactatttgacatgtcggccttcatg
gctggcccaggaaatgcaaagaaagtggtagagaatggggctctcctgtcctggaaacta
ggctgctccttgaaccagaatagcgtccctgacatccgtggtgtagaaacccctgctagg
gagggtgctatgtctgcccaacttggttatcctgtggtgggttggcacattgccaataag
aagcccactctccccaaacgactccggaggcagatccacgccacacctacacctgttact
gccattggacccccaaccacggccattcaggagccaccatcgcggatagtgcctacgcct
acatctccagccattgcacctccaacagagaccatggctcctcctgtcagggatcctgtt
ccagggaagcccacggtcaccattcggacgcgaggtgccattattcagaccccaactctg
ggccctatccagcctactcgggtgtcagaagctggtaccacggttcctggccagattcgc
ccaacactgacaattcctggctatgtagagcccacagccgttattactcctccaacaact
accacaaagaagccacgagtgtccacgccaaagccagcaacgccttcaactgattcgtca
actaccacaactcggaggccaaccaaaaaaccacggacaccccgaccagtgccccgagtc
accaccaaagcacccatcaccaggttggagacagcttccccacccactcgaatccgtact
accaccagtggagtgccccgtgggggagaacctaaccagcggccagagctcaagaatcac
attgacagggtagatgcctgggtgggaacctattttgaggtaaagattccatcagacacc
ttctatgacaatgaggataccactaccgacaagctcaagctgaccctgaagcttcgagag
cagcagttagtaggtgagaaatcgtgggttcagtttaacagcaacagccagctcatgtat
ggcctgcctgacagcagccatgtgggaaaacatgagtattttatgcatgccacagacaaa
gggggcctctccgctgtggatgccttcgagatccatgttcacaagcgcccacaaggggac
aaggctcctgcacggttcaaggccaggcttgcaggggatccagcaccggtggtgaatgac
attcacaagaaaattgctttggtaaagaagctagcttttgcttttggggatcgaaactgc
agctccatcacccttcagaacatcactcggggctctatcgtggtggaatggaccaacaac
actctgcccctggagccctgccccaaggagcagatcatagggctgagccgcaggattgct
gatgaaaatgggaagcctcgtcctgccttctccaatgctctggagcctgactttaaggct
ctgagtattgctgtgacgggctctggcagttgtcggcacctccagtttatccctgtggca
ccaccctctcctggaagctcagctgcaccagccacagaggttccagacagggaccccgag
aagagcagtgaggacgatgtttacctgcacaccgttatcccagccgtggtggtcgcggcc
atcctgctcattgctggaatcattgctatgatctgctatcgcaagaagaggaagggcaag
ctgacccttgaggaccaggccacctttattaagaagggggtgcctatcatctttgcggat
gagctggatgactctaagcccccgccctcttccagcatgccgctcatcttgcaggaagag
aaggctcccctcccacctcctgagtaccccaaccagagtatgcccgagaccactcctctg
aaccaggacactgtgggagagtacacacccctgcgggatgaggatcctaacgcacctccc
tatcagccacccccacccttcacggctcccatggagggcaagggctcccgtcccaagaac
atgaccccataccgatcaccccctccgtatgttcccccttaa

DBGET integrated database retrieval system