KEGG   Mus musculus (mouse): 13142
Entry
13142             CDS       T01002                                 

Gene name
Dao, AI987963, D, DAAO, DAMOX, Da, Dao-1, Dao1
Definition
(RefSeq) D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00330  Arginine and proline metabolism
mmu00472  D-Arginine and D-ornithine metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    13142 (Dao)
   00330 Arginine and proline metabolism
    13142 (Dao)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    13142 (Dao)
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    13142 (Dao)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    13142 (Dao)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     13142 (Dao)
SSDB
Motif
Pfam: DAO ADH_zinc_N_2 UDPG_MGDP_dh_N Glyco_trans_4_5
Other DBs
NCBI-GeneID: 13142
NCBI-ProteinID: NP_001273325
MGI: 94859
Ensembl: ENSMUSG00000042096
Vega: OTTMUSG00000024124
UniProt: P18894 A0A0R4J203
Position
5 F; 5 55.93 cM
AA seq 345 aa
MRVAVIGAGVIGLSTALCIHERYHPTQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSN
PQEAEWSQQTFDYLLSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKNAVLGFRKLTPSE
MDLFPDYGYGWFNTSLLLEGKSYLPWLTERLTERGVKLIHRKVESLEEVARGVDVIINCT
GVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGIF
QLGNWSGLNSVRDHNTIWKSCCKLEPTLKNARIVGELTGFRPVRPQVRLEREWLHFGSSS
AEVIHNYGHGGYGLTIHWGCAMEAANLFGKILEEKKLSRLPPSHL
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgcgcgtggccgtgatcggagcaggagtcattgggctctccacagccctctgcattcat
gagcgttaccacccaacacagccactgcacatgaagatctatgcagatcgattcaccccg
ttcaccacgagcgatgtggccgccggcctctggcagccttatctctctgaccccagcaac
cctcaggaggcggagtggagccagcaaacgtttgattacctgctgagctgcctccattct
ccaaacgctgaaaaaatgggcctggccctaatctcaggctacaacctcttccgagatgaa
gttccggaccctttctggaaaaacgcagttctgggattccggaagctgacccccagtgag
atggacctgttccctgattatggctacggctggttcaatacaagcctccttctagagggg
aagagctacctgccatggctaactgagaggttaactgagaggggagtgaagcttatccat
cggaaggtggagtctctcgaagaggtggcaagaggagtggatgtgattatcaactgcacc
ggggtgtgggccggggccctgcaagcagatgcctccctgcagccaggccggggccagatc
atccaggtggaggccccttggattaaacacttcatcctcacccatgatcctagccttggt
atctacaactctccgtacatcatcccaggttccaagacagttacgctcgggggtatattc
cagctggggaactggagcgggttaaacagcgtccgtgaccacaataccatttggaagagc
tgctgtaaactggagcccaccctgaagaatgcaagaattgtgggtgaactcactggcttc
cggccagtccggcctcaggtccggctagaaagagaatggcttcattttggatcttcaagt
gcagaggtcatccacaactatggtcatggaggttacgggctcacaatccactggggttgt
gcaatggaggcggccaacctcttcgggaaaattctagaggaaaagaagttgtccaggttg
cctccctcccacctctga

DBGET integrated database retrieval system