KEGG   Mus musculus (mouse): 13144
Entry
13144             CDS       T01002                                 

Gene name
Dapk3, ZIPK, dlk
Definition
(RefSeq) death-associated protein kinase 3
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu05200  Pathways in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    13144 (Dapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13144 (Dapk3)
  09162 Cancer: specific types
   05219 Bladder cancer
    13144 (Dapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13144 (Dapk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13144 (Dapk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   13144 (Dapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Choline_kinase
Other DBs
NCBI-GeneID: 13144
NCBI-ProteinID: NP_001177402
MGI: 1203520
Ensembl: ENSMUSG00000034974
UniProt: O54784 Q05A21
Position
10 C1; 10 39.72 cM
AA seq 448 aa
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREE
IEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKVRRREDGARKPERRRLRAARLREY
SLKSHSSMPRNTSYASFERFSRVLEDVAAAEQGLRELQRGRRQCRERVCALRAAAEQREA
RCRDGSAGLGRDLRRLRTELGRTEALRTRAQEEARAALLGAGGLKRRLCRLENRYDALAA
QVAAEVQFVRDLVRALEQERLQAECGVR
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtccacattcaggcaagaggatgttgaggaccattatgagatgggagaggagcttggc
agtggccaatttgccatcgtgcgcaagtgccagcagaagggcacgggcatggagtatgca
gccaagttcatcaagaagcggcgcctgccatccagccggcgcggtgtgagccgggaggag
atcgaacgcgaggtgagcatcctgcgcgagatccgccaccccaacatcataacactgcat
gacgtgttcgagaacaagacagatgtggtgctgatcctggagctggtgtccggtggcgag
cttttcgacttcctggccgagaaggagtcattgacggaggatgaggccacgcagttcctc
aaacaaatcctagacggtgtccactacctgcactccaagcgcatcgcacactttgacctg
aagcccgagaacatcatgttgctggacaagcacgcagccagcccccgcattaagctcatc
gactttggcatcgcgcacaggatcgaggctggcagcgagttcaagaacatctttggcaca
cccgagtttgtcgcccccgagatcgtgaactatgagccacttggcttggaggctgacatg
tggagcattggcgtcatcacctacatcctcctgagcggagcgtccccattcctgggcgag
accaagcaggagacgctgacgaacatctcagcagtgaactatgactttgatgaggaatac
ttcagcagcaccagcgagctggccaaggacttcatccgcaggctgctggtcaaagacccc
aagaggaggatgaccatcgcacagagcctggagcattcctggatcaaggtgcgcaggcgc
gaggacggcgcccggaagccagagcgacggcggctgcgcgccgcgcgcctgcgcgagtac
agcctcaagtcccactcgagcatgccgcgcaacacgagctacgccagcttcgagcgcttc
tcacgcgtgctggaggacgtggcggcggcagagcaggggctgcgcgagctgcagcgaggc
aggcgccagtgccgggagcgcgtgtgtgcgctgcgcgcggccgccgagcagcgggaggcg
cgctgccgcgacgggagcgcagggctagggcgcgacctgcgacgcctgcgcacggagctg
gggcgcaccgaggctctgcgcacgcgcgcgcaggaggaggcgcgggcggcgctgttgggt
gccgggggcctgaagcgtcgcctgtgtcgcctggagaaccgttacgacgcgctagccgct
caggtggccgctgaggtgcaattcgtgcgcgacctggtgcgtgcgctggagcaggaacgg
ctgcaggctgagtgcggcgtgcgctag

DBGET integrated database retrieval system