KEGG   Mus musculus (mouse): 13162Help
Entry
13162             CDS       T01002                                 

Gene name
Slc6a3, DAT, Dat1
Definition
(RefSeq) solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
  KO
K05036  solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04728  Dopaminergic synapse
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    13162 (Slc6a3)
   04721 Synaptic vesicle cycle
    13162 (Slc6a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    13162 (Slc6a3)
  09165 Substance dependence
   05030 Cocaine addiction
    13162 (Slc6a3)
   05031 Amphetamine addiction
    13162 (Slc6a3)
   05034 Alcoholism
    13162 (Slc6a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    13162 (Slc6a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   13162 (Slc6a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 13162
NCBI-ProteinID: NP_034150
MGI: 94862
Ensembl: ENSMUSG00000021609
UniProt: Q61327
Position
13 C1; 13 40.1 cM
AA seq 619 aa AA seqDB search
MSKSKCSVGPMSSVVAPAKEPNAVGPREVELILVKEQNGVQLTNSTLINPPQTPVEVQER
ETWSKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPVLKGVGFTVILISFYVGFFYNVIIAWALHYFFSSFTMDLPWIHC
NNTWNSPNCSDAHSSNSSDGLGLNDTFGTTPAAEYFERGVLHLHQSRGIDDLGPPRWQLT
ACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAMDGIRAYLSVD
FYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIITTSINSLTSFSSG
FVVFSFLGYMAQKHNVPIRDVATDGPGLIFIIYPEAIATLPLSSAWAAVFFLMLLTLGID
SAMGGMESVITGLVDEFQLLHRHRELFTLGIVLATFLLSLFCVTNGGIYVFTLLDHFAAG
TSILFGVLIEAIGVAWFYGVQQFSDDIKQMTGQRPNLYWRLCWKLVSPCFLLYVVVVSIV
TFRPPHYGAYIFPDWANALGWIIATSSMAMVPIYATYKFCSLPGSFREKLAYAITPEKDR
QLVDRGEVRQFTLRHWLLV
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagcaaatgctccgtgggaccaatgtcttctgtggtggccccggctaaagag
cccaatgctgtgggccccagagaggtggagctcatcttggtcaaggagcagaatggagtg
cagctgaccaactccaccctcatcaacccaccgcagacaccagtggaggttcaagagcgg
gagacctggagcaagaaaatcgatttcctgctctcagtcatcggcttcgctgtggacctg
gccaatgtctggaggtttccctacctgtgctacaaaaatggtggaggtgccttcctggtg
ccctacctgctcttcatggttattgccgggatgcccctcttctacatggagctggctctc
gggcagttcaacagagaaggagctgctggtgtctggaagatctgccctgtcctgaaaggt
gtgggcttcactgtcatcctcatctctttctacgtgggcttcttctacaatgtcatcatt
gcatgggcactgcactacttcttctcctccttcaccatggacctcccatggatccactgc
aacaacacctggaacagccccaactgctctgatgcacatagcagcaactctagcgatggc
ctgggcctcaacgacacctttgggaccacacccgctgctgagtattttgagcgtggtgtg
ctgcacctccatcagagtcgtggcattgatgacctgggccctccacggtggcagctcaca
gcctgcctggtgctggtcattgttctgctctacttcagcctgtggaagggagtaaagact
tcagggaaggtggtgtggatcacagctaccatgccctatgtagtcctcacagccctgctc
ctgcgtggagtcaccctccctggggccatggatggcatcagagcatacctcagtgtggac
ttctaccgtctctgtgaggcatctgtgtggatcgatgccgccacccaggtgtgcttctcc
cttggcgttgggtttggggtgctgattgccttctccagttacaataagttcaccaataac
tgctatagagatgcaatcatcaccacctccattaactccctgacgagcttctcctctggc
ttcgttgtcttctccttcctggggtacatggcacagaagcacaatgtgcccatcagggat
gtggccacagatggacctgggttgatcttcatcatctaccctgaggcaatcgccacactc
ccgctgtcttcagcctgggccgctgtcttcttcctcatgctgctcactctgggtatcgac
agtgccatggggggcatggagtctgtgatcactgggcttgtcgatgagttccagctgcta
catcggcatcgagagctcttcactcttggcattgtcctggctactttcctgctgtctctc
ttctgtgtcaccaacggtggcatctatgtcttcacactgctggaccactttgcagctggc
acatctatcctctttggagtgctcattgaagccattggggtggcctggttctacggtgtc
cagcaattcagtgatgacatcaagcagatgactgggcagcgacccaacctgtactggcgg
ctatgctggaagctggtcagcccctgcttccttctgtatgtggtcgtggtcagcattgtg
accttcagacccccacactatggagcctacatcttcccagactgggccaatgccctgggc
tggatcattgccacatcctccatggccatggtgcccatttatgccacctataagttctgc
agcctgccagggtccttccgagagaaactggcctatgccatcacacctgagaaagaccgc
cagctagtggacagaggggaggtgcgccaattcacgctgcgccattggctgttggtgtaa

DBGET integrated database retrieval system