KEGG   Mus musculus (mouse): 13175Help
Entry
13175             CDS       T01002                                 

Gene name
Dclk1, 1700113D08Rik, 2810480F11Rik, AI836758, Click-I, Cpg16, Dcamkl1, Dcl, Dclk, mKIAA0369
Definition
(RefSeq) doublecortin-like kinase 1
  KO
K08805  doublecortin-like kinase 1/2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13175 (Dclk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13175 (Dclk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  DCAMKL family
   13175 (Dclk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase DCX Pkinase_Tyr Kdo Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 13175
NCBI-ProteinID: NP_064362
MGI: 1330861
Ensembl: ENSMUSG00000027797
Vega: OTTMUSG00000053093
UniProt: Q9JLM8
Position
3; 3 C
AA seq 756 aa AA seqDB search
MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVR
FYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSL
DQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGGPSEVRENK
DFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGVVKRLYTLDGK
QVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASASRRGTTKSPG
PSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRISQHGGSSTSLSSTK
VCSSMDENDGPGEGDELGRRHSLQRGWRREESEEGFQIPATITERYKVGRTIGDGNFAVV
KECIERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLV
MELVKGGDLFDAITSTSKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQD
GSKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGF
PPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKELINMMLLVNVDQRFSAVQVLEH
PWVNDDGLPENEHQLSVAGKIKKHFNTGPKPSSTAAGVSVIATTALDKERQVFRRRRNQD
VRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcggcagagatatggagttggagcattttgatgagcgggacaaggcgcagagg
tacagcagggggtcccgtgtgaatggcctgcccagccccacacacagcgcccactgcagc
ttctaccgcacccgcaccctgcagacactcagctccgagaagaaagccaagaaggttcga
ttctacagaaatggtgaccgctacttcaaaggaattgtgtatgccatctccccagaccgc
ttcagatctttcgaggccctgctggctgatttgacccgaactctctcggataatgtgaat
ttgccccagggggtgagaaccatctacaccatcgatggactcaagaagatctccagcctg
gaccagctggtggaaggtgaaagctatgtctgcggctccatcgagccctttaagaagctg
gagtacaccaagaatgtgaaccccaactggtcagtgaacgtcaagaccacctcagcctcc
cgcgcagtgtcttctttggccactgccaagggtgggccttcggaggttcgggagaataag
gatttcattcgacccaagctggtcaccatcatcagaagtggggtgaagccacggaaggct
gtcagaatcctgctgaacaagaagacggctcactccttcgagcaggttctcactgacatt
accgacgctatcaagctggactccggtgtggtgaagcgcctgtacactctggatgggaag
caggtgatgtgccttcaggacttttttggtgacgatgacatttttattgcatgtggacca
gagaagttccgttaccaggatgatttcttgctagatgaaagtgaatgtcgagtggtgaaa
tcaacttcttacaccaaaatagcatcagcgtcccgcagaggcacaaccaagagcccagga
ccttcccggagaagcaagtccccagcctccaccagctcagttaatggaacccctggtagt
cagctctctactccacgctcgggcaagtcaccaagtccatcacccaccagcccaggaagc
ctgcggaagcagaggatctctcagcatggcggctcctcgacttcactttcatccactaaa
gtttgcagctcaatggatgagaatgatggccctggggaaggtgatgagcttgggagaagg
cacagcttgcagaggggatggaggagggaagagtctgaggaaggcttccagattcctgcc
acaataacagagagatacaaagtcgggagaacaataggagacggaaattttgctgttgtc
aaggaatgtatagagaggtcgactgctcgggagtatgccctgaaaatcatcaagaaaagc
aaatgccgaggcaaagagcacatgatccagaacgaggtctccatcctacggagggtgaag
caccccaacattgtcctcctgattgaagagatggatgtgccgactgaactgtatcttgta
atggaattagtgaagggtggagaccttttcgatgccatcacctccactagcaaatacaca
gagagagatgccagcgggatgctgtacaacctggccagcgccatcaaatacctgcacagc
ctgaacatcgtccaccgtgacatcaagccagagaatctgctggtgtatgagcaccaggat
ggcagtaagtcactcaagttgggtgactttggcctggccacaattgtcgacggccccctg
tacacagtctgtggcaccccaacatatgtggctccagaaatcattgcagagactggatat
ggcctcaaggtggacatctgggcagctggcgtgatcacttatatcctgctgtgtggcttc
cctccgttccgtggaagtggggatgaccaggaggtgctttttgaccagatcttgatgggc
caagtggactttccatctccgtattgggacaatgtgtcagattctgctaaggagctcatc
aacatgatgctgttggttaacgtggaccagagattttcagccgtgcaggtccttgagcat
ccctgggttaatgatgatggtctcccagaaaatgagcatcagctgtcagtagctggcaaa
atcaagaagcatttcaacacaggccccaagccgagcagcactgcagcaggagtttctgta
atagcaaccaccgctcttgataaggagaggcaggttttccgacgaagacgcaaccaggat
gtgaggagccggtacaaggcgcagccagctccaccggaattgaactcggaatcggaggac
tactcccccagctcctctgagactgttcgctcccccaattcgcccttttaa

DBGET integrated database retrieval system