KEGG   Mus musculus (mouse): 13178Help
Entry
13178             CDS       T01002                                 

Gene name
Dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00240  Pyrimidine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    13178 (Dck)
   00240 Pyrimidine metabolism
    13178 (Dck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     13178 (Dck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 CoaE
Motif
Other DBs
NCBI-GeneID: 13178
NCBI-ProteinID: NP_031858
MGI: 102726
Ensembl: ENSMUSG00000029366
Vega: OTTMUSG00000025239
UniProt: P43346 Q545E8
Position
5; 5 E1
AA seq 260 aa AA seqDB search
MATPPKRFCPSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQASEDWEVVPEPVARWCN
VQSTQEEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTSFDYLQEVPVLTLDVNE
DFKDKHESLVEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccacctaagaggttctgcccttctccctcgaccagctccgaggggacccgc
atcaagaagatctccatcgaggggaacatcgctgctgggaagtcaacgtttgtgaatatc
ctaaagcaagcctctgaggattgggaagtggttcccgagcctgtggccaggtggtgcaac
gtgcagagcactcaagaggaatttgaggaattgacaacgtctcagaagagcggtggaaat
gttcttcaaatgatgtatgagaaacctgaacggtggtctttcaccttccagtcatatgcc
tgtctcagccggatccgagcccagctagcctctctcaatggcaagctcaaagatgcagag
aaacctgtattattttttgaaagatctgtgtatagtgacaggtacattttcgcttctaat
ttgtacgaatctgactgcatgaatgaaacagagtggaccatatatcaagactggcacgac
tggatgaacagccagtttggccaaagccttgaattggatggaataatctatcttcgagct
actcccgagaaatgcttaaacagaatatacctacggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaaacttcactataaacatgaaagctggctccttcatcggact
ctgaaaaccagctttgattatctgcaagaggtgcccgtcctcacactggatgttaatgaa
gactttaaagacaaacacgaaagcctggttgaaaaggtcaaagaatttctgagtactttg
tga

DBGET integrated database retrieval system