KEGG   Mus musculus (mouse): 13179
Entry
13179             CDS       T01002                                 

Gene name
Dcn, DC, DSPG2, PG40, PGII, PGS2, SL, SLRR1B
Definition
(RefSeq) decorin
  KO
K04660  decorin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    13179 (Dcn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    13179 (Dcn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    13179 (Dcn)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    13179 (Dcn)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRRNT LRR_9
Other DBs
NCBI-GeneID: 13179
NCBI-ProteinID: NP_001177380
MGI: 94872
Ensembl: ENSMUSG00000019929
UniProt: P28654 Q3UKR1
Position
10 C3; 10 50.27 cM
AA seq 354 aa
MKATLIFFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVV
QCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAF
KPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNP
LKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLI
NLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNIS
AVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaaggcaactctcatcttcttccttctggcacaagtctcttgggctggaccatttgaa
cagagaggcttatttgacttcatgctagaagatgaggcttctggcataatcccttatgac
cctgacaatcccctgatatctatgtgcccctaccgatgccagtgtcatcttcgagtggtg
cagtgttctgatctgggtttggacaaagtgccctgggattttccacccgacacaaccttg
ctagacctgcaaaacaacaaaattacagagatcaaagaaggggccttcaagaacctgaag
gacttgcataccttgatccttgtcaacaacaagatcagcaaaatcagtccagaggcattc
aaacctctcgtgaagttggaaaggctttacctgtctaagaaccaactaaaggaactgcct
gaaaaaatgcccagaactctccaggaacttcgtgtccatgagaatgagatcaccaagctg
cggaaatccgacttcaatggactgaacaatgtgcttgtcatagaactgggcggcaaccca
ctgaaaaactctgggattgaaaacggagccttccagggactgaagagtctctcatacatt
cgcatctcagacaccaacataactgcgatccctcaaggtctgcctacttctctcactgaa
gtgcatctagatggcaacaagatcaccaaggttgatgcacccagcctgaaaggactgatt
aatttgtctaaactgggattgagcttcaacagcatcaccgttatggagaatggcagtctg
gccaatgttcctcatctgagggaactccacttggacaacaacaaactcctcagggtgcct
gctgggctggcacagcataagtatatccaggtcgtctaccttcacaacaacaacatctcc
gcagttgggcaaaatgacttctgccgagctggacacccctctcgaaaggcttcctactcg
gctgtgagtctttacggcaaccctgtccggtattgggaaatctttccaaacaccttcaga
tgtgtctatgtgcgttctgccattcaacttggaaactacaagtaa

DBGET integrated database retrieval system