KEGG   Mus musculus (mouse): 13191Help
Entry
13191             CDS       T01002                                 

Gene name
Dctn1, AL022633, DAP-150, DP-150, Glued, p150, p150-glued, p150<glued>
Definition
(RefSeq) dynactin 1
  KO
K04648  dynactin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    13191 (Dctn1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    13191 (Dctn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13191 (Dctn1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    13191 (Dctn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    13191 (Dctn1)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    13191 (Dctn1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     13191 (Dctn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     13191 (Dctn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynactin CAP_GLY Fez1
Motif
Other DBs
NCBI-GeneID: 13191
NCBI-ProteinID: NP_031861
MGI: 107745
Ensembl: ENSMUSG00000031865
Vega: OTTMUSG00000024506
UniProt: O08788 Q3TRF1
Position
6 C3; 6 35.94 cM
AA seq 1281 aa AA seqDB search
MAQSRRHMSSRTPSGSRMSTEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE
GADAAAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPALTSPGAAPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEDSTMQLADHIKFTQSALDCMGVEVGRLRAFLQGGQEATDI
ALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCTILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQ
ADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEPQRGGAPGQAPGA
LPGPGLVKDSPLLLQQISAMRLHISQLQHENSILRGAQMKASLAALPPLHVAKLSLPPHE
GPGGNLVAGALYRKTSQLLEKLNQLSTHTHVVDITRSSPAAKSPSAQLMEQVAQLKSLSD
TIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGLG
QRHRLVLTQEQLHQLHSRLIS
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atggcccagagcaggaggcacatgtccagtcggacgccgagtggcagcaggatgagtacg
gaggcaagcgcccggcccctgcgggttggctcccgcgtggaggtgattgggaagggccac
cgaggcactgtggcctatgttggagccacactctttgccactggcaaatgggtgggcgtg
attctggatgaagcaaaaggcaaaaatgatggcactgtccagggaaggaagtatttcaca
tgtgatgaaggccacggcatctttgtacgccagtcccagatccaagtatttgaagatgga
gcagatactacttccccagagactcctgattcttctgcttcaaaggtcctcaagagagag
ggagccgatgcagctgcaaagaccagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcgacggcccaagcctactcgcccagccagcactggggtg
gctgggcccagtagctcccttggcccctctggctcagcgtcagccggggaactaagcagc
agtgagcccagcaccccagctcagactccgctggcagcacccatcatccccacaccggcc
ctcacctctcctggagcagcacccccacttccatctccctctaaggaagaggaagggctg
agggctcaggtacgggacctggaggagaagctggagaccctgcgcctaaaacgctcagaa
gacaaagcaaagctgaaagagctggagaagcacaagatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggcagacctgcagcggcgcctcaaggaggctcgg
aaggaagccaaggaggcgctagaggcaaaggaacgctacatggaggagatggccgacaca
gccgacgctatcgagatggccactctggacaaggagatggctgaagagcgcgctgagtct
ctgcagcaagaggtggaggcactgaaggaacgggtagacgagctcaccacagacctggag
attctcaaggctgaaatcgaagagaaaggctctgatggggccgcatcaagctaccagctc
aagcagctggaggagcagaatgcccgcctgaaggatgccctggtgaggatgcgagacctc
tcttcctcagagaagcaggagcacgtgaagctgcagaaactcatggaaaagaaaaaccag
gagctggaggtcgtgcggcagcagcgcgagcgtcttcaggaggagctgagccaggctgag
agcaccatcgatgagctcaaagagcaggtggacgccgctctgggagccgaggagatggtg
gagatgctgaccgaccggaacctgaatctagaggagaaagtgcgggagttacgggagact
gtgggggacttggaagccatgaacgagatgaacgatgagctgcaggagaacgcacgggag
acggagctggaactccgagagcagctggacatggcgggcgcccgagtgagggaagcgcag
aagcgagtggaagccgcccaggagacagtcgccgactaccagcagaccatcaagaagtac
cgccagttgactgcccacctacaggatgtcaatcgggagctgacaaaccagcaggaagcg
tctgtagagaggcagcagcagccgccgccagagacttttgatttcaaaatcaagtttgct
gagaccaaggctcatgccaaggccattgagatggagttgagacagatggaagttgcccag
gccaaccggcacatgtccctgctgacagcctttatgcctgacagcttccttcggccaggt
ggagaccacgactgtgtcctggtgctgctgctcatgccccgactcatttgcaaggcagag
ctcatccggaagcaggcccaggagaagtttgacctgagcgagaactgttcggagcggccc
gggctgcggggagctgccggggagcagctgagctttgctgctggactggtgtactcgctg
agtctgctgcaggccacgctgcaccgctatgagcatgccctctctcagtgcagtgtggac
gtgtataagaaggtcggcagcctgtaccccgagatgagcgcccacgagcgctccttagat
ttcctcattgagctgctgcacaaggatcagctggatgagactgtcaacgtggagcccctc
accaaggccatcaagtattaccagcatctgtacagcatccacctcgctgaacaacccgag
gactccaccatgcagctggctgaccacatcaagttcacccagagtgccctggactgcatg
ggcgtggaggtggggcggctgcgtgccttcttgcagggtgggcaggaggcaacagatatt
gcccttcttctccgagacctggaaacatcatgtagtgacacccgtcagttctgcaagaag
atccgaaggcggatgccggggacggatgctcctgggatcccagcagcgctggcctttggc
tcacaggtatccgacacactcctggactgcaggaagcacttgacgtgggtggtagctgtt
ctgcaggaggtggcagctgcagccgcccagcttattgcccccttggcagagaacgagggg
ctgcctgtggctgcactggaggagctggccttcaaagcaagcgagcagatctacgggagc
ccctccagcagcccctatgagtgtctacgccagtcatgcaccatcctcatcagcacgatg
aacaagctggccacagccatgcaagaaggcgagtatgacgcagagcgacccccgagcaag
cctcctccggttgaacttcgggctgcagccctgcgtgcagagatcacagatgctgaaggt
ctgggtttgaagcttgaggatcgagagacagttatcaaggagttaaagaagtcactcaag
attaagggagaggagctgagtgaggccaacgtgcggctcagcctcctggagaagaagttg
gacagcgctgccaaggatgcagacgagcgaatcgagaaagttcagacacggctggacgag
actcagaccctgctgcggaagaaggagaaagactttgaggagacaatggacgcactccag
gctgacatcgaccagctggaggcagagaaggcagagctcaagcagcgcctgaacagccag
tccaagcgcacaatcgaggggctccggggcccccctccgtcaggcatcgctaccctggtc
tctggcatcgctggtgaggaaccacagcgagggggcgctcctgggcaggctccgggcgcc
ttgccaggcccggggctggtgaaggactccccactgctgcttcagcagatctctgctatg
aggctacacatctctcagctccagcatgagaacagcatcctcagaggagcccagatgaag
gcgtccttggcagctctgccccctctgcatgttgcaaagctttccctcccaccccatgag
ggccccggtggtaacctagtggctggggcactgtaccgcaagaccagccagctcctggag
aaactaaaccagctgagtacccacacccacgtggtggatatcactcggagcagcccagct
gccaagagcccgtcagctcagcttatggaacaagtggctcagctcaagtccctgagtgac
accattgagaagctcaaggatgaggtcctcaaggagacagtgactcagcgccctggagcc
actgtgcccaccgactttgccactttcccttcatctgccttcctcagggccaaggaagag
cagcaagatgacacagtctacatgggcaaagtgaccttttcatgcgcggcaggcctagga
cagcgacaccgcctggtgctgacccaggagcagctgcaccagcttcacagtcgcctcatc
tcctaa

KEGG   Mus musculus (mouse): 67665Help
Entry
67665             CDS       T01002                                 

Gene name
Dctn4, 1110001K06Rik, 4930547K17Rik, C130039E17Rik, p62
Definition
(RefSeq) dynactin 4
  KO
K10426  dynactin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    67665 (Dctn4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    67665 (Dctn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67665 (Dctn4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67665 (Dctn4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     67665 (Dctn4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     67665 (Dctn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynactin_p62
Motif
Other DBs
NCBI-GeneID: 67665
NCBI-ProteinID: NP_080578
MGI: 1914915
Ensembl: ENSMUSG00000024603
UniProt: Q8CBY8 Q3TQY2
Position
18; 18 D3
AA seq 460 aa AA seqDB search
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSD
KYSLGTRLQRPRAGASISTLAGLSLREGEDQKEVKIEPAQAVAEVEPLPEDYYTRPVNLT
EVTTLQQRLLQPDLQPVSASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECDEGDPDNINSTAKVVV
PPKELILAGKDAAAEYDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEVTVCFK
MKHDFKNLAAPIRPVEEGDQGTEVIWLTQHVELSFGPLLP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccctgctgcagtcggagcgggttctctatctcgtccaaggagaaaagaaggtt
cgggctccgctctcacagctctacttctgccgctactgcagtgagcttcgatcgctggaa
tgtgtgtcgcacgaggtggactcacattattgtcccagctgcttagaaaacatgccgtca
gctgaagccaaattaaaaaagaatagatgtgccaactgctttgactgtcctggatgcatg
cacaccctttctacccgtgcaacaagcatctccacacagcttcccgatgacccagccaaa
accaccatgaagaaagcctattacttggcctgtggattttgtcgatggacatctagagat
gtgggcatggcagacaaatctgtcgctagtggtggttggcaagaaccagaaaaccctcac
acacaacggatgaacaagttgattgagtattaccagcagcttgctcagaaggaaaaggtc
gaacgagatcgcaagaagctggcacggcgaagaaattacatgcctttggctttttcggac
aagtacagtcttgggaccaggcttcagcgaccacgagctggtgcatccatcagtacactt
gctggactttcccttagagaaggagaagatcagaaagaggtgaagattgagccggctcag
gctgtcgctgaagtggagcctctgcctgaagactattacacgcggccagtgaacctaaca
gaagtgaccacccttcagcagcgcctcttacagcccgacctacagccagtctctgcttca
cagctttatcctcgacacaagcaccttctgatcaaacggtccctgcgctgtcggaaatgt
gagcacaacttgagcaagccagaatttaatccaacatctatcaaattcaaaatccagttg
gttgctgtcaattatattccagaagtgagaatcatgtcaatccccaaccttcgctacatg
aaggagagccaggtcctcttgactcttacaaatccagtggagaacctcacccatgtgact
ctgttggagtgtgacgagggggaccctgataatatcaacagcactgctaaggtggtggtg
cctcccaaagagctcatcttagccggcaaggatgcagcagcagaatatgatgagctggca
gagccccaggacttccaggatgaccctgacatcgtagctttcagaaaagccaacaaagtg
ggcatcttcatcaaagtcaccccacagcgtgaggaaggggaagtgaccgtgtgcttcaag
atgaaacacgattttaaaaacctggctgcccccatccgcccagtggaagaaggtgaccaa
ggcacagaggtcatctggctcacgcagcacgtggagctgagctttggccctcttcttcct
taa

KEGG   Mus musculus (mouse): 69654Help
Entry
69654             CDS       T01002                                 

Gene name
Dctn2, 2310042E05Rik, C130077D06Rik, C87049, DCTN-50, GMP23-48K, RBP50, p50
Definition
(RefSeq) dynactin 2
  KO
K10424  dynactin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    69654 (Dctn2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    69654 (Dctn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    69654 (Dctn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    69654 (Dctn2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     69654 (Dctn2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     69654 (Dctn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamitin ALIX_LYPXL_bnd ZapB PI_PP_I
Motif
Other DBs
NCBI-GeneID: 69654
NCBI-ProteinID: NP_081427
MGI: 107733
Ensembl: ENSMUSG00000025410
UniProt: Q99KJ8 Q3TPZ5
Position
10 D3; 10 74.5 cM
AA seq 402 aa AA seqDB search
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELSSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGDYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLADPDGALAKRLLLQ
LEATKSSKGSSGGKATAGAPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVR
CDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKAS
VEDADTQNKVHQLYETIQRWSPVASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQM
MASSLKDNTALLTQVQTTMRENLATVEGNFASIDARMKRLGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgatctccccggcattgccaggaatgagccagacgtttat
gaaaccagcgacctacctgaggatgatcaagcagagtttgatgcggaggaactgagcagc
acaagcgtggaacacatcattgtcaaccccaacgctgcctacgacaagttcaaggacaag
agagtgggaacaaaggggcttgatttctcagatcgcattggaaagaccaagaggacagga
tatgagtctggagactatgaaatgcttggagagggtctgggagtgaaggagacaccgcag
cagaagtaccaacgactactgcatgaagtccaagagctgacaactgaggtggagaagatc
aagacgacagtgaaggagtcagccaccgaggagaagctcacccctgtggtgctggctaag
cagctggctgccctgaagcagcagctggtggcttcccacctggagaagcttctgggacca
gatgctgcaatcaaccttgccgacccagacggagccctagctaagcgcttactgctgcag
ctggaagcaactaagagcagcaaaggcagttcagggggtaaggctacagctggggccccc
ccagacagcagcctggtcacctatgaactccactcacggcctgagcaggacaagttctct
caagctgccaaagttgcagaactcgagaagcgtctgacagagctggaggccactgtccga
tgtgaccaggatgctcagaatcccctttctgcaggtctacagggagcctgccttatggaa
acggtagaactgttgcaagccaaagtgagtgccctggaccttgcagttctggaccaagta
gaggctcggcttcagagtgtcctgggaaaggtgaatgagattgctaagcacaaggcatcc
gtggaggacgcagacactcagaacaaggtgcaccagctctatgagaccatccagcgctgg
agcccagtcgcctccaccctccctgaactggtacagcgacttgtcaccatcaagcagctg
catgagcaagctatgcagtttggtcagctcctgacacacttggataccacccagcagatg
atggccagttcccttaaggataatactgctctcctgacccaggtgcagacaacgatgcgt
gaaaacttggccacagttgaggggaactttgccagcattgatgctcggatgaagaggctg
ggaaagtga

DBGET integrated database retrieval system