KEGG   Mus musculus (mouse): 13194
Entry
13194             CDS       T01002                                 

Gene name
Ddb1, 127kDa, AA408517, p127-Ddb, p127-Ddb1
Definition
(RefSeq) damage specific DNA binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04120  Ubiquitin mediated proteolysis
mmu05161  Hepatitis B
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    13194 (Ddb1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    13194 (Ddb1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    13194 (Ddb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    13194 (Ddb1)
   05161 Hepatitis B
    13194 (Ddb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    13194 (Ddb1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    13194 (Ddb1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     13194 (Ddb1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      13194 (Ddb1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      13194 (Ddb1)
SSDB
Motif
Pfam: MMS1_N CPSF_A Beta_propel
Other DBs
NCBI-GeneID: 13194
NCBI-ProteinID: NP_056550
MGI: 1202384
Ensembl: ENSMUSG00000024740
UniProt: Q3U1J4
Position
19 A; 19 6.66 cM
AA seq 1140 aa
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPGRE
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQGKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDSSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGEA
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgtcgtacaactacgtcgtaacggcgcagaagcctactgcagtgaacggctgtgtgacc
ggacactttacttcagcggaagatctgaacctgttgattgctaaaaacacaagattagag
atctatgtggtcactgcggagggtcttcggccagtcaaagaggtgggaatgtacgggaag
attgcagtcatggagctcttcaggcccaagggggagagcaaagacctgctgttcatcttg
actgctaaatacaatgcctgtatcttggagtataagcagagtggcgaaagcattgacatc
attacaagagcccatggcaatgtccaggaccgcattggtcgcccctcggagactggcatc
attggcatcattgaccctgagtgccgtatgattggccttcgactctacgatggccttttc
aaggtcattccactagaccgagacaataaagagctcaaggcctttaacatccgcctagag
gaactgcacgtcattgatgtcaagttcctgtatggttgtcaagcacctaccatttgcttt
gtctaccaggatcctcaggggcggcatgtgaaaacctatgaggtgtctcttcgagagaag
gagttcaacaagggcccttggaaacaggagaatgtagaagccgaagcttcaatggtgata
gcagtcccagagccttttggaggtgccatcatcattggacaggaatcaatcacctatcat
aacggtgataaatacctggcaattgctcctcctatcattaagcaaagcactattgtgtgc
cataaccgggtggatcctaatggctcgcggtaccttctgggagatatggagggacggctt
ttcatgctgctcttagagaaggaggagcagatggatggcactgtcaccctcaaggacctt
cgagtggaactcctcggagagacctccattgctgagtgcctaacttatcttgataatggt
gttgtatttgtcgggtctcgcctaggtgactcccagctcgtaaagctcaatgtcgacagc
aacgaacaaggctcctatgtagtggccatggaaacctttaccaatttaggacccattgtg
gatatgtgtgtggtggacctggagaggcagggacagggtcagctggtcacttgctctgga
gctttcaaggaaggttccttgcggatcatccggaacggcattggaatccatgagcatgcc
agcattgacttaccaggcatcaaaggtttatggcctctgcgctctgaccccggtcgggag
acggatgacactttggtgctctcttttgtgggccagacaagagttctcatgctaaacgga
gaggaagtggaagagacagaactgatgggctttgtggacgatcagcagactttcttttgt
ggcaacgtggctcatcagcaacttatccagatcacctcagcatctgtgaggttggtgtct
caagagcccaaagctttggtcagcgagtggaaagagcctcagggcaagaacatcagtgtg
gcctcctgtaacagcagccaggtggttgttgccgtgggaagggcactatattaccttcag
atccaccctcaggagctccggcaaatcagccacacagagatggaacatgaagtggcatgc
ttggatatcaccccattaggggacagcaatggcctctccccactttgtgccattggactt
tggacagacatctcagctcgtatcctgaagctcccatcctttgaactactacacaaggag
atgctgggtggagagatcattcctcgatccatcctgatgaccacttttgagagtagccac
tacctcctttgtgccttgggagatggggctcttttctactttgggctcaacatcgagaca
ggtttactgagtgaccgtaaaaaggtgactttgggcacccagcccacggtgttgaggaca
ttccgttctctttctaccaccaacgtctttgcttgctctgaccggcccactgtcatctat
agcagcaatcacaagttggtcttctccaatgtcaacctcaaggaggtgaactatatgtgt
cctctcaactcagatggctatcctgacagtctggcattggccaataacagcactctcacc
attggcaccatcgatgagatccagaagctccatattcgcacagttcccctctatgagtct
cccaggaagatctgctatcaggaagtgtctcagtgctttggggtcctttccagccgcatt
gaagtccaagatagcagtggaggcactactgctttgaggcccagtgccagcacccaggcc
ctgtccagcagcgtcagctccagcaaacttttctccagcagtacggctcctcacgagacc
tcctttggagaagaagtggaggtgcacaacctcctcatcattgaccagcacacctttgaa
gtgcttcacgcccatcagtttctacaaaacgagtatgccctcagcctggtctcctgcaag
ttgggtaaagaccccaacacttacttcattgtgggcacagccatggtatatcctgaagag
gcagagcccaagcagggtcgtattgtggtcttccagtattcagatggaaaactacagact
gtggctgaaaaggaagtaaaaggagctgtgtactctatggtggagtttaatgggaagctg
cttgccagcatcaatagcacggtgcggctctatgagtggaccacagaaaaggagcttcgc
actgagtgtaatcactacaacaacatcatggccctgtacctgaagaccaagggcgacttc
atcctggtgggcgacctcatgcgctcagtgctgctgcttgcctacaagcctatggaagga
aactttgaagagattgcccgagactttaatcccaactggatgagtgcagtggagatcttg
gatgatgacaattttctgggagctgaaaatgcctttaacttgtttgtgtgtcagaaggac
agtgctgccaccactgatgaggagcggcagcacctacaggaggttggtctcttccacctg
ggcgagtttgtcaatgtgttctgccatggctccctagttatgcagaatctgggcgaggct
tctacccctacacagggctcggtgctctttggcacagtcaacggcatgatagggctggtg
acctcgctgtcagagagctggtataacctcctgttggacatgcagaaccgactcaataag
gtcatcaaaagcgtgggcaagattgagcactccttctggagatcctttcacactgagcga
aagacagaaccagccacaggcttcatcgatggtgatctgattgaaagtttcctagatatc
agccgccctaagatgcaggaggttgtggcaaacttgcagtatgatgatggcagtggtatg
aagcgggaggcaactgcagatgacctcatcaaagtcgtggaggagctaactcggatccat
tag

DBGET integrated database retrieval system