KEGG   Mus musculus (mouse): 13198Help
Entry
13198             CDS       T01002                                 

Gene name
Ddit3, CHOP-10, CHOP10, chop, gadd153
Definition
(RefSeq) DNA-damage inducible transcript 3
  KO
K04452  DNA damage-inducible transcript 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13198 (Ddit3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13198 (Ddit3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    13198 (Ddit3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13198 (Ddit3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    13198 (Ddit3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13198 (Ddit3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    13198 (Ddit3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GAS bZIP_2 bZIP_1 DivIC GIT_CC Fungal_TACC DUF5595 DASH_Hsk3 DASH_Spc19 WDCP DLP_helical MAJIN RR_TM4-6 DUF5094 PRKG1_interact DUF4407 Phlebovirus_NSM Neur_chan_memb CDC45
Motif
Other DBs
NCBI-GeneID: 13198
NCBI-ProteinID: NP_001277112
MGI: 109247
Ensembl: ENSMUSG00000025408
Vega: OTTMUSG00000032537
UniProt: P35639 Q3V405
Position
10; 10 D3
AA seq 168 aa AA seqDB search
MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgagtccctgcctttcaccttggagacggtgtccagctgggagctggaagcc
tggtatgaggatctgcaggaggtcctgtcctcagatgaaattgggggcacctatatctca
tccccaggaaacgaagaggaagaatcaaaaaccttcactactcttgaccctgcgtcccta
gcttggctgacagaggagccagggccaacagaggtcacacgcacatcccaaagccctcgc
tctccagattccagtcagagttctatggcccaggaggaagaggaggaagagcaaggaaga
actaggaaacggaaacagagtggtcagtgcccagcccggcctgggaagcaacgcatgaag
gagaaggagcaggagaacgagcggaaagtggcacagctagctgaagagaacgagcggctc
aagcaggaaatcgagcgcctgaccagggaggtggagaccacacggcgggctctgatcgac
cgcatggtcagcctgcaccaagcatga

DBGET integrated database retrieval system