KEGG   Mus musculus (mouse): 13199
Entry
13199             CDS       T01002                                 

Gene name
Ddn, Gm748
Definition
(RefSeq) dendrin
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Dendrin
Other DBs
NCBI-GeneID: 13199
NCBI-ProteinID: NP_001013763
MGI: 108101
Ensembl: ENSMUSG00000059213
UniProt: Q80TS7
Structure
PDB: 
6J69

Position
15 F1; 15 54.69 cM
AA seq 710 aa
MLDGPLFSEGPDSPRELQDEESGSCLWVQKSKLLVIEVKTISCHYSRRAPSRQSMDIQAS
YWARGPQSRTCRLRPGSPEPPPRRPWASRVLQEATNWRAGPPAEVRAREQEKRKAASQER
EAKETERKRRKAGGARRSPLGQPRPEPRNALRAAQPTGFPVFSRPERFGQVGRAPRPSVL
PQGDPGVAWAGPWGGRRPGPPSYEAHLLLRGSAGTAPRRRWDRPPPYVAPPSYEGPHRTL
GTKRGPELSRAPTSSAPVPATTRTEGGRTKKRLDPRIYRDVLGAWGLRQGRGLLGGAPGC
TAARARPESCKGAIEKSSGLVAAGLNSAGDSHSQGKTTGGPGTDAALSRSAISSPPRPVP
RSRQHLRGSRKGKEGSEQIWLPTCWLASPKKPPVRHSQTLPRPWAPGGTGWKESLGQREG
AEHETLEVWKVTRRAHTLPRISRGPAGREGIFVIDATCVVIKSQYVPTPRTQQGQLVPSG
ESCSVSDSLSQPKPCHEEEGEGAAANPSVCQKRLLSSRVLNQPSEGRECEAEVGQQGDSS
LEERSSSGLGFPVGEVNPRDAPTQPGSQEHPTLGPAAPVCAGSLKGSEAAGVPRRAGGGW
ARTPGPYAGALREAVSRIRRHTAPDSDSDEAEDLSVHSGSSDGSDTDAPGASWRNERTLP
ALGNTRPREGGKTAGLSDSIREIVDVISQTEEGFIREDTRKTPQGNRERE
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgctggatggcccgttattctccgaggggcccgacagcccccgggagctccaggatgag
gagtccggcagctgcctctgggtgcagaagtccaagctgttggtgattgaagtgaagact
atttcctgtcattatagtcgtcgcgctccttctcgacagtccatggacatccaggccagc
tactgggcccgtgggccccagagccgcacgtgtaggctgcgcccgggatcccctgagccg
ccaccccgccgaccctgggcctccagggtgctgcaggaggcaaccaactggcgggcgggc
ccccccgccgaggtccgagcccgggaacaagagaaaagaaaggcggcgtcgcaggagcgg
gaggccaaggagaccgagagaaaaaggcgcaaggctggcggggcccgacggagtccccta
ggtcagccccgcccagagccccggaacgcccttcgggcagcccaacctacagggtttcca
gttttctccagaccagagcgcttcgggcaggtggggcgagcgccccgaccatccgtgctc
ccgcagggtgacccaggggttgcatgggcggggccatggggaggcagaaggccagggccc
cctagctacgaggctcacctgctgttgagaggctctgcaggcacagccccaaggcgccgc
tgggaccggccgccaccctatgtggctccaccttcttatgaaggtccccacaggaccctg
gggactaagcgaggcccggagctctcccgggcgcccacctcatcagccccagttccagcc
accaccaggacagagggagggcgcacgaagaagaggctggatcctcgaatctaccgggat
gttctaggagcttggggtctcagacagggacggggactcttaggaggtgctccaggctgt
acagcagccagagctaggccagagtcttgcaaaggggctatagagaaaagctcaggccta
gttgctgctggcctgaacagtgctggcgatagtcattcccaaggcaaaacgactggcggt
ccaggcacggacgcagctctctctaggtccgcgatcagcagcccacctcgtcctgttccc
aggtccaggcagcacctcagggggtcaaggaaagggaaagaaggaagtgagcagatatgg
cttcccacgtgttggcttgcctcccctaaaaagcctccagttaggcacagccagacgctc
cctagaccctgggctcctggaggcaccgggtggaaagagtccctgggtcaaagagagggg
gcagaacatgagaccctggaagtttggaaggtgacccgccgtgcccacaccctgccccgc
atttcccgaggtcccgctggtagagaaggcatctttgtcattgacgccacatgcgtggtg
ataaagtcccagtacgttccgacccctcgaacccagcagggtcagctcgtgccctctggg
gagtcgtgcagtgtgagcgacagccttagtcaacccaagccctgtcacgaggaggagggc
gagggggccgctgccaacccttcagtttgccaaaagcgactgttgagcagtcgagtctta
aaccaaccgagcgagggtcgcgagtgcgaggccgaggtcggacagcagggggattcttca
ttggaggagcgctcctccagcggtttggggttccctgtcggagaagtgaacccgcgagac
gcccccacgcagccaggtagccaagagcacccgaccttaggcccagcggctccggtatgc
gccggcagcttgaagggctcagaagcggctggtgtcccgcggcgcgcgggcgggggctgg
gcgcggactccagggccctacgccggggcgttgcgagaagccgtgtcccgcatccgccgc
cacaccgccccagattcggactcagacgaagcggaggatctcagcgtccatagcggctcc
tctgatggaagcgacacagacgccccaggcgcctcctggcggaatgagaggaccctgcct
gcgcttgggaacacccggcccagggaaggcgggaagacagcagggctgagcgacagtatc
cgggagattgtggatgtcatcagtcaaaccgaggaaggcttcatccgagaggacaccagg
aaaacgccacagggaaatagagagagggagtga

DBGET integrated database retrieval system