KEGG   Mus musculus (mouse): 13209Help
Entry
13209             CDS       T01002                                 

Gene name
Ddx6, 1110001P04Rik, C430015D01Rik, E230023J21Rik, HLR2, mRCK/P54, p54, rck
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 6
  KO
K12614  ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Module
mmu_M00395  Decapping complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    13209 (Ddx6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13209 (Ddx6)
   03036 Chromosome and associated proteins [BR:mmu03036]
    13209 (Ddx6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     13209 (Ddx6)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     13209 (Ddx6)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     13209 (Ddx6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Gene silencing
   piRNA pathway
    13209 (Ddx6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C CMS1 ResIII ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 13209
NCBI-ProteinID: NP_001104296
MGI: 104976
Ensembl: ENSMUSG00000032097
Vega: OTTMUSG00000063351
UniProt: P54823
Position
9 A5.2; 9 24.84 cM
AA seq 483 aa AA seqDB search
MSTARTENPVIMGLSSQNGQLRGPVKASAGPGGGGTQPQPQLNQLKNTSTINNGTPQQAQ
SMAATIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPS
PIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQV
SQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHV
QMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL
MEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYS
CFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH
RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPAED
EKP
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggccagaacagagaaccctgttatcatgggtctgtccagtcagaacggccag
ctgaggggccctgtgaaggccagtgctggccctggaggagggggcacacagccacagcca
cagctgaaccagttgaagaacaccagcacaatcaataatggcactccacagcaagcccag
agcatggccgccactattaaacctggtgatgactggaaaaagacattaaaactccctcca
aaggatctaagaatcaaaacttcggatgtgacctccacaaaaggaaatgagtttgaagat
tactgtttgaaacgagagttgctaatgggaatttttgaaatgggctgggaaaaaccatct
cctatccaggaggagagcattcccattgctttatctggtagggatatcttagctagagca
aaaaatggaacaggcaaaagcggtgcctacctcatccccttacttgaaaggctggacctg
aagaaggacaatattcaagcaatggtgattgttcccactagagaacttgctctacaggtc
agtcagatttgcatccaggtcagcaaacacatgggaggggccaaagtgatggcaaccacc
ggaggaaccaatttacgagatgacataatgaggcttgatgatacagtgcatgtggtgatc
gctacccctggcaggatcctggatctcatcaagaaaggcgtggcaaaggttgaccatgtc
cagatgatagtgctagatgaggcagataaattgttgtcacaggattttgtgcagataatg
gaggatattattctcacactacctaaaaataggcagattttactatactccgctactttc
cctcttagtgtacaaaagtttatgaattcccatctgcaaaaaccctacgagataaacctg
atggaggaactaactctgaaaggagtaactcagtactacgcatatgtaacggagcgccaa
aaagtgcactgcctcaatacacttttctccaggcttcagataaaccagtccatcattttc
tgcaactcctcccagagagtcgagctactcgccaagaagatttctcagctgggctactct
tgcttttatatccatgctaaaatgaggcaggaacatcgaaatcgtgtctttcatgatttc
cgaaatggcttatgccgcaatcttgtttgcactgatctgtttacccgaggtattgatata
caagctgtgaatgtggtaataaactttgacttcccaaagctggcagagacctatcttcat
cgtattggaagatcaggtcgctttggtcatcttggcttagccatcaacttgatcacttat
gatgatcgcttcaacctgaagagtattgaggagcagctggggacagagatcaaacccatc
ccaagcaacatcgacaagagcctgtatgtggcagaataccacagtgagcctgcagaagac
gagaaaccgtaa

DBGET integrated database retrieval system