KEGG   Mus musculus (mouse): 13214
Entry
13214             CDS       T01002                                 

Symbol
Defb1, AW260221, BD-1
Name
(RefSeq) defensin beta 1
  KO
K23125  beta-defensin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    13214 (Defb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13214 (Defb1)
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 13214
NCBI-ProteinID: NP_031869
MGI: 1096878
Ensembl: ENSMUSG00000044748
Vega: OTTMUSG00000019983
UniProt: P56386 Q3UQE2
Position
8 A2; 8 10.35 cM
AA seq 69 aa
MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCK
PDKPNCCKS
NT seq 210 nt   +upstreamnt  +downstreamnt
atgaaaactcattactttctcctggtgatgatatgttttcttttctcccagatggagcca
ggtgttggcattctcacaagtcttggacgaagaacagatcaatacaaatgccttcaacat
ggaggattctgtctccgctccagctgcccatctaataccaaactacagggaacctgtaaa
ccagataagcccaactgttgtaagagctga

DBGET integrated database retrieval system