KEGG   Mus musculus (mouse): 13214
Entry
13214             CDS       T01002                                 

Gene name
Defb1, AW260221, BD-1
Definition
(RefSeq) defensin beta 1
  KO
K23125  beta-defensin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    13214 (Defb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13214 (Defb1)
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 13214
NCBI-ProteinID: NP_031869
MGI: 1096878
Ensembl: ENSMUSG00000044748
Vega: OTTMUSG00000019983
UniProt: P56386 Q3UQE2
Position
8 A2; 8 10.35 cM
AA seq 69 aa
MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCK
PDKPNCCKS
NT seq 210 nt   +upstreamnt  +downstreamnt
atgaaaactcattactttctcctggtgatgatatgttttcttttctcccagatggagcca
ggtgttggcattctcacaagtcttggacgaagaacagatcaatacaaatgccttcaacat
ggaggattctgtctccgctccagctgcccatctaataccaaactacagggaacctgtaaa
ccagataagcccaactgttgtaagagctga

KEGG   Mus musculus (mouse): 244332
Entry
244332            CDS       T01002                                 

Gene name
Defb14, BD-14
Definition
(RefSeq) defensin beta 14
  KO
K23126  beta-defensin 103
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    244332 (Defb14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    244332 (Defb14)
SSDB
Motif
Pfam: Defensin_beta Defensin_beta_2
Other DBs
NCBI-GeneID: 244332
NCBI-ProteinID: NP_898847
MGI: 2675345
Ensembl: ENSMUSG00000046354
Vega: OTTMUSG00000020600
UniProt: Q7TNV9
Position
8; 8 A1.3
AA seq 67 aa
MRLHYLLFVFLILFLVPAPGDAFLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGR
KCCRKKK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgaggcttcattatctgctatttgtattcctcatcttgttcttggtgcctgctccaggg
gacgcattcctaccaaaaaccctccgaaaatttttctgcagaataagaggtggccggtgt
gctgtacttaactgccttggaaaggaagaacaaataggtcgatgttctaatagcggtcga
aaatgctgccgaaagaagaagtag

KEGG   Mus musculus (mouse): 56519
Entry
56519             CDS       T01002                                 

Gene name
Defb4, 2310001F05Rik, BD-4
Definition
(RefSeq) defensin beta 4
  KO
K21100  beta-defensin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    56519 (Defb4)
   04657 IL-17 signaling pathway
    56519 (Defb4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    56519 (Defb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    56519 (Defb4)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   56519 (Defb4)
SSDB
Motif
Pfam: Defensin_beta Innexin
Other DBs
NCBI-GeneID: 56519
NCBI-ProteinID: NP_062702
MGI: 1927667
Ensembl: ENSMUSG00000059230
Vega: OTTMUSG00000020596
UniProt: P82019 Q499H9
Position
8; 8 A1.3
AA seq 63 aa
MRIHYLLFTFLLVLLSPLAAFTQIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCC
KIR
NT seq 192 nt   +upstreamnt  +downstreamnt
atgaggatccattaccttctcttcacatttctcctggtgctgctgtctccacttgcagcc
tttacccaaattatcaacaatccaataacatgcatgaccaatggagccatatgctggggt
ccgtgccctaccgcttttcgacagattggcaattgtggccattttaaagtcagatgctgt
aagataagatag

DBGET integrated database retrieval system